DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn77Ba

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:400 Identity:72/400 - (18%)
Similarity:159/400 - (39%) Gaps:83/400 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QNVSFQLIREID---RYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEV 84
            |:.:..|::.|.   ....::|::|..::..:|..::.....|:.|.|::||.||....:.|...
  Fly    77 QDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAY 141

  Fly    85 LDWGLRYKKASSAKFQMANKVAV--SQKLPLSQKLRLVNEVLMTSAKKYDVTKDVRPSKL----- 142
            ..|. .:...:::..::|...|:  .:..|:....|       .:.:.|    :|:|.::     
  Fly   142 KVWS-SFLNITTSTIEVATLQAIYTGKGYPIKNNYR-------DAIQNY----NVQPMEVDFYSP 194

  Fly   143 -----MDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRY--FVNNPGT 200
                 ::|..:....|::...:..:.: .|..:..:|.:.....|...|...:.|.  |.:..|.
  Fly   195 DSVIQINEDTNRTTRGLIPYTILPQDV-YGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGE 258

  Fly   201 GYASKDPTCVPMMHSLSSFETMSTDEAKGIYI---PFSSAN-LGMLILLPRKGVTCKDILDNL-- 259
            ....     :|||...::|..:|..|....|:   |:.:.: |.|:::||::|....|:.:||  
  Fly   259 VIGK-----IPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKA 318

  Fly   260 -------------NNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAK 311
                         .|:.    ::..:|.:::|.|....|:.:......:.|.|.|.::.      
  Fly   319 LGLRPILQRLAAFRNRA----SEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENT------ 373

  Fly   312 IKINNFRVNHGIRFQPILRLE--VVDDIDT---GKTET----------FEVNRPFVFVIKDKIN- 360
              .|..|::.|:..:.::...  :||:..|   ..||.          |.:||||.::|.:|.. 
  Fly   374 --ANLDRMSSGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATG 436

  Fly   361 -VYAVGRIEN 369
             :...|::.|
  Fly   437 LLLFAGQVRN 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 71/396 (18%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 71/396 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.