DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb3d

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:406 Identity:85/406 - (20%)
Similarity:154/406 - (37%) Gaps:98/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FQLIREIDR---YTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEVLDWG 88
            ::.:||.|.   |:|   :..:..:.|:|.   .|||   |.:.:...:::|  :|..::..:  
Mouse    16 YRQLRESDNNIFYSP---ISMMRTLAMLLL---GAKA---NTEQQIKKVLHF--NETTKKTTE-- 67

  Fly    89 LRYKKASS-------AKFQM----ANKV--AVSQKLP-----------LSQKLRLVNEVLMTSAK 129
               |.|.|       .:|||    .||.  |...|:|           |...|:.:.:....:.:
Mouse    68 ---KSAESHDEENVHQQFQMLMTQLNKFNNAYDLKVPNSIYGAKDFPFLQTFLKDIRKYYQANVE 129

  Fly   130 KYDVTKDVRPS-KLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINR- 192
            ..|.......| |.::.|::...:|.:.:......||:...:|.::.:.....|...|..:..| 
Mouse   130 SLDFAHAAEESQKKINSWMARQTNGKIKDLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHTRE 194

  Fly   193 --YFVNNPGTGYASKDPTCVPMMHSLSSFETMSTD--EAKGIYIPFSSANLGMLILLPRKGVTCK 253
              :::|.    ..||.   |.||...:.|..:..:  :||.:.||:....|.|.:|||.:    .
Mouse   195 EKFWLNK----NTSKP---VQMMKQRNKFNFIFLENVQAKIVEIPYKGKELSMFVLLPVE----I 248

  Fly   254 DILDNLNNQINVE--------YNDH-KDVHLLLPIFK--EKFDYNIAKFFNGINIEDTFKDSAFK 307
            |.|.....|:..:        .|.| .:::|.||.||  ||:|..:.  ...:.:.|.|      
Mouse   249 DGLKKFEEQLTADKLLQWTRAENMHMTELYLSLPQFKVEEKYDLRVP--LEHMGMVDAF------ 305

  Fly   308 SKAKIKINNFRVNHGIRFQPILRLEVVDDIDTG-----------------KTETFEVNRPFVFVI 355
            ...|...:....:.|:....:|....|:..:.|                 |...|..|.||:||:
Mouse   306 DPQKADFSGMSNSQGLVVSKVLHKSFVEVNEEGAEAATAMSVESRSLSVPKPNDFSCNHPFLFVM 370

  Fly   356 K-DKIN-VYAVGRIEN 369
            | :|.| :...||:.:
Mouse   371 KQNKTNSILFFGRVSS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 84/402 (21%)
Serpinb3dNP_958764.1 SERPIN 7..387 CDD:294093 85/406 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.