DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and serpine2

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:408 Identity:88/408 - (21%)
Similarity:163/408 - (39%) Gaps:94/408 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIFLVLCTSLLFQNTIQ------QNVSFQLIREI--DRYTPENFVLSVLNIEMILFEIHAAKAVE 62
            |:|| ||:..:.|:...      .::..|:..::  || ..||.:||...:..:|          
Zfish     9 VLFL-LCSVSVSQSQSSSYGARGSDLGLQVFMQVLQDR-AQENVLLSPHGVASVL---------- 61

  Fly    63 SNNDLERSLIINFGYSEARQEVLDWGLRYKKASSAKFQMANK-------------VAVSQKLPLS 114
                   .:::...:.:.|:::|: ||:|||  :..::|..|             |.::..|..:
Zfish    62 -------GMLLPGAHGDTRRQLLN-GLKYKK--NGPYKMLRKLHKSLTTKSNADIVTIANALFPN 116

  Fly   115 QKLRLVNEVLMTSAKKY-------DVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLN-AGENIV 171
            :...:..:.|..:.:.:       |.:.....::.:::|:.:...|.:.:.|.....: |...:|
Zfish   117 EGFSMKEDFLSANRENFLCESHSVDYSDPEAAAQSINDWVKNSTKGQIPSVVTADMFDTALTRLV 181

  Fly   172 AISGMTVTPLWASHFQSEIN--RYFVNNPGTGYASKDPTCVPMMHSLSSF---ETMSTDEAKGIY 231
            |::.:....||.|.||.:..  |.|....|..|.      ||||..||.|   :..:.|..|.|.
Zfish   182 AVNSIFFKGLWKSRFQPQSTKPRSFTAGDGNTYK------VPMMSQLSVFNMGQASTPDGQKYIV 240

  Fly   232 I--PFSSANLGMLILLPRKGVT-CKDILDNLN-NQIN--VEYNDHKDVHLLLPIF---------- 280
            |  |:...::.|.|.||.:..| ...||.::: |.|.  .:..:.:.:.||:|.|          
Zfish   241 IELPYHGNSMSMFIALPTEDSTPLSSILPHISTNTIQSWTKLMNPRRMRLLMPKFTVEQELDLET 305

  Fly   281 -------KEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQPILRLEVVDDID 338
                   |:.||.|.|. |..::.|..:...|.: ||||::|............||...      
Zfish   306 PLKALGIKDIFDQNKAD-FRHLSSESIYVSKALQ-KAKIEVNEDGTKASATTSVILHAR------ 362

  Fly   339 TGKTETFEVNRPFVFVIK 356
             .......|:|||:|:|:
Zfish   363 -SSPPWVTVDRPFLFLIR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 82/392 (21%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 82/390 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.