DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and AT1G62160

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:170 Identity:41/170 - (24%)
Similarity:70/170 - (41%) Gaps:38/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PMMHSLSSFETM---STDEAKGIYIPF------SSANLGMLILLPRKGVTCKDI----------L 256
            |.|....:||..   :.|..|.:.:|:      ::.|..|...||.|.....|:          |
plant    51 PKMRGHKNFEKQYIAAYDGFKVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGFL 115

  Fly   257 DNLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNH 321
            |:...:..||.::.:     :|.||.:|.:..:..|:...|     |.:|..||.|:|:    ..
plant   116 DSHTPRERVEVDEFR-----IPKFKIEFGFEASSVFSDFEI-----DVSFYQKALIEID----EE 166

  Fly   322 GIRFQPILRLEVVDDID-TGKTET--FEVNRPFVFVIKDK 358
            |.  :.......||:.| .|..||  |..:.||:|:|:::
plant   167 GT--EAAAATAFVDNEDGCGFVETLDFVADHPFLFLIREE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 41/170 (24%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 41/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.