DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb6b

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_038951899.1 Gene:Serpinb6b / 364705 RGDID:1310452 Length:388 Species:Rattus norvegicus


Alignment Length:389 Identity:66/389 - (16%)
Similarity:137/389 - (35%) Gaps:86/389 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SFQLIREIDRYTPENFVLSVLNIEMILFEIH-AAKAVESNNDLER----------SLIINFGYSE 79
            :|.|::.:...:.:|.:.|.|:|...|..:. .||...::..::.          |..::.|:..
  Rat    12 AFNLLKTLGEDSSKNVLFSPLSISSGLAMVFMGAKGTTAHQMIQALSLDKCSGRGSRDVHQGFQS 76

  Fly    80 ARQEVLDWGLRYK-------------------KASSAKFQMANKVAVSQKLPLSQKLRLVNEVLM 125
            ...:|...|.:|.                   |.:..||..|....:..|....|..:.:|..:.
  Rat    77 LLAKVNKTGTQYLLKTANRLFGEKTFDILASFKDACRKFYEAEMEELDFKGAPEQSRQHINTWVA 141

  Fly   126 TSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEI 190
            ...:...::.:....|.:.|.|||            ..:||...:|.::.:.....|...|..|.
  Rat   142 KKTEGQSISLNWNSQKKITELLSS------------GSVNANTPLVLVNAIYFKGNWKKQFNKED 194

  Fly   191 NRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDEAKG--IYIPFSSANLGMLILLPRKGVTCK 253
            .:.....    ....:...|.||...|:|:....:|...  :.:|:....|.|:|:||.:.:..:
  Rat   195 TQEMPFK----VTKNEEKPVKMMFKKSTFKMTYVEEISTTILLLPYVGNELNMIIMLPDEHIELR 255

  Fly   254 DILDNLNNQINVEYN-----DHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKD-----SAFKS 308
            .:...:..:..:|:.     :.::|.:.||.||.:.::::....:.:.:.|.|:.     |...|
  Rat   256 MVEKEITYKKFIEWTSLDKMEEREVEVFLPKFKLEENHDMKDVLHRLGMTDAFEQGMADFSGIAS 320

  Fly   309 KAKIKINNFRVNHGIRFQPILRLEVVDDIDTGKTET----------------FEVNRPFVFVIK 356
            |           .|:....::....|:..:.| ||.                |..|.||:|.|:
  Rat   321 K-----------EGLFLSKVIHKSFVEVNEEG-TEAAAATAANVTFRCMVPYFCANHPFLFFIQ 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 66/389 (17%)
Serpinb6bXP_038951899.1 serpin 1..388 CDD:422956 66/389 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.