DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn42De

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster


Alignment Length:428 Identity:94/428 - (21%)
Similarity:170/428 - (39%) Gaps:99/428 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CTSLLFQ-------NTIQQNVS--------FQLIREIDR-YTPENFVLSVLNIEMILFEIHAAKA 60
            |:.||.|       ||:..:.|        .||..::.: .:..|.|.|..:|...|...:....
  Fly     7 CSLLLLQGLNLAMANTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAE 71

  Fly    61 VESNNDLERSLIINFGYSEARQEVLDWGL---RYKKASS----AKFQMANKVAVSQKLPLSQKLR 118
            ..:.::|:..|.:.........|.||..|   :::|||.    .|.:.||::.|:|:..|:|..:
  Fly    72 GSTADELKLGLGLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQ 136

  Fly   119 -LVNEVLMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLW 182
             ||::....:|:..:.|:....:|.::.|:.......:.:.:..:.|:|..:.:.::.:.....|
  Fly   137 DLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADW 201

  Fly   183 ASHFQSEINRY---FVNNPGTGYASKDPTCVPMMHSLSSFETMSTDE-----------AKGIYIP 233
            .|.| .:...|   |||:.|...               |.:|||.::           ||.:.:|
  Fly   202 QSSF-PDYATYASDFVNHGGRKV---------------SVDTMSQEDYFRFGELTELKAKVVELP 250

  Fly   234 FSSANLGMLILLPRK------------GVTCKDILDNLNNQINVEYNDHKDVHLLLPIFKEKFD- 285
            ::..::..||:||::            |:...:|...|.         .:.|.:.||.||.:|| 
  Fly   251 YTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLR---------RRKVRVQLPKFKFEFDV 306

  Fly   286 --------YNIAKFFN-GINIEDTFKD------SAFKSKAKIKINNFRVN-HGIRFQPILRLEVV 334
                    ..|.|.|: |.|:...::.      |..|.||.|::|..... .|..|..:    .|
  Fly   307 PLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKV----SV 367

  Fly   335 DDIDTGKTETFE--VNRPFVFVIKDKINVYAVGRIENL 370
            :.:..|: |.||  .:.||.|.|||..|...:|.:..|
  Fly   368 ESLTIGE-EVFEFIADHPFFFAIKDAQNTLFLGHVSQL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 87/406 (21%)
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 86/399 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.