DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn42Dc

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster


Alignment Length:369 Identity:82/369 - (22%)
Similarity:152/369 - (41%) Gaps:61/369 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NFVLSVLNIEMIL----FEIHAAKAVESNNDLE------RSLIINFGYSEARQEVLDWGLRYKKA 94
            |.|.|..:::..|    .....:.|.|..|.|:      ..:.:|||  |..:...::|.|    
  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFG--EFWRTSCNYGDR---- 91

  Fly    95 SSAKFQMANKVAVSQKLPLSQKLRLVNEV----LMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVL 155
             ....:..|::.|:..|.|   |...||:    ..:.|:..........::|:::|:....:..:
  Fly    92 -GPVLKSVNRLYVNDSLEL---LTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKI 152

  Fly   156 ANFVQEKKLNAGENIVAISGMTVTPLWASHFQSE---INRYFVNNPGTGYASKDP-TCVPMMHSL 216
            .|.:|...:|...:.:.|:.:.....|...|..|   |:.:.|:        :|. ..|.||:..
  Fly   153 TNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVD--------RDTHVQVNMMYQE 209

  Fly   217 SSFETMSTDE--AKGIYIPFSSANLGMLILLPRKGVTCKDILDNLNNQIN-VEYND------HKD 272
            ..|......:  |:.:.:|:..:|:.||||||.:    .:.|..|..|:| |:..|      .:|
  Fly   210 DKFRFAELPQLKARAVQLPYDYSNIHMLILLPNE----VNGLQELEQQLNTVDLADIDAALTLQD 270

  Fly   273 VHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSA-----FKSKAKIKINNFR------VNH-GIRF 325
            |.:.||....::|.::.:..|.:.|.:.|.|.|     |.|::..||:..|      ||. |...
  Fly   271 VEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEA 335

  Fly   326 QPILRLEVVDDIDTGKTETFEVNRPFVFVIKDKINVYAVGRIEN 369
            ..:..:::|..:.....:.|:.:.||||.|::...|:..||..|
  Fly   336 AAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQAVFFAGRFSN 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 80/365 (22%)
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 80/365 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.