DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn28Dc

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster


Alignment Length:286 Identity:59/286 - (20%)
Similarity:95/286 - (33%) Gaps:100/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IDRYTPENFVLSVLNIEMILFEIHAAKA---VESNNDLERSLII--------------------- 73
            :|..|.:....||||...||.: |.|..   :.|...:..||.:                     
  Fly   100 VDLATSDRIANSVLNFANILGQ-HLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPD 163

  Fly    74 ------NFGYS------------EARQEVLDWGLRYKKASSAKFQMANKVAVSQKLPLSQKLRLV 120
                  .||..            .|.:.:.||     :||||  ..:|:.|   :.|.:.::.|.
  Fly   164 TSRLHEQFGLMLQDLQQPTREAISAGRPLTDW-----RASSA--MRSNRRA---QRPGAHEVHLA 218

  Fly   121 NEVLMTSAKKYDVTKDVRPSKLMDEWLSSHL-----DGVLAN-------FVQEKKLNAGENIVA- 172
            |.:...:.  |.:..|.|  :::.|..:|.|     :|..|.       :|.:...|..|||:| 
  Fly   219 NGLFTQTG--YTLNPDYR--RVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIAS 279

  Fly   173 ----------ISGMTVTPLWASHFQSEINR---YFVNNPGTGYASKDPTCVPMMHSLSSFETMST 224
                      .:.:.....|.:.|.....|   ::.|..||         .|:|.    .:.|:|
  Fly   280 DIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGT---------EPVMR----VQMMAT 331

  Fly   225 DEAKGIYIPFSSANLGMLIL-LPRKG 249
            .   |.|.......||..|: ||.:|
  Fly   332 G---GAYPYHEDHELGCKIIGLPYRG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 59/286 (21%)
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 57/275 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.