DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn28Da

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster


Alignment Length:392 Identity:91/392 - (23%)
Similarity:169/392 - (43%) Gaps:60/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLVLCTSLLFQNTIQQNVSFQLIREIDRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLI 72
            ::::.||:|.|.|.|...||  :::..:|   |.:.|.|.:|:.:..|.......:.|:|..:| 
  Fly     6 WILVTTSVLGQFTKQLYRSF--LQDNKQY---NIIASPLCVEIGMSMILMGADGNTANELRTAL- 64

  Fly    73 INFGYSEARQEV----------LDWGLRYKKASSAKFQMANKVAVSQKLPLSQKL-RLVNEVLMT 126
               ...|.::.|          |:.|   ||.  |...:||::.|::.:.::::. :|||:....
  Fly    65 ---NLPEDKKNVATIYDKLLTKLERG---KKV--AILHLANRLFVNETIGVNKRYNKLVNKHFRA 121

  Fly   127 SAKKYDVTKDVRPSKLMDEW-LSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEI 190
            .|:...:...::.:..:::| |...||.| .:.:....|...|:.|.|:.......|.:.| .::
  Fly   122 EAEAIKLADRLKAAWAINDWVLDQTLDNV-KDIIIPSDLTPDESAVMINAAFFKGYWKTRF-DKM 184

  Fly   191 NRYFVNNPGTGYASKD-PTCVPMMHSLSSFETMSTDEAKGIYIPFSSANLGMLILLPRKGVTCKD 254
            |    ..|...|.||. ...|.||..:..|:..::...:.|.:||:.:||.|:|:||:...:...
  Fly   185 N----TKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQ 245

  Fly   255 ILDNLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRV 319
            ....:.:...:...: .|||:.||.||..|...:.:....:.|:|.|..|   |...:.:|    
  Fly   246 AEATIESYPQIVLTE-MDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSS---SDISVLLN---- 302

  Fly   320 NHGIRFQPILRLEVVDDIDTG-------------------KTETFEVNRPFVFVIKDKINVYAVG 365
            ..|.|...::....::..:.|                   ...||.||.||||:|:|..|:|..|
  Fly   303 QSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDNIYFRG 367

  Fly   366 RI 367
            |:
  Fly   368 RV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 85/376 (23%)
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 87/380 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.