DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn28B

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:405 Identity:89/405 - (21%)
Similarity:164/405 - (40%) Gaps:84/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCTSL-------LFQNTIQQNVSFQLIREIDRYTPENFVLSVLNIEMILFEIHAAKAVESNND 66
            |:|.||:       .::....||....||     |:|       ::.|:|:..::.|...::..:
  Fly     7 LLLATSVESGFWEDFYRILASQNAKRNLI-----YSP-------ISAEIIMSMVYMASGGKTFEE 59

  Fly    67 LERSLIINFGYSEARQEVLDWGLRYKK-ASSAK-------FQMANKVAVSQKLPLSQKL-RLVNE 122
            |...|    .:||.:..|.:   .|:. .|..|       ..|||::.|::|..|..:. :|..:
  Fly    60 LRNVL----KFSENKTLVAN---NYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARK 117

  Fly   123 VLMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHF- 186
            .....||...:...|..|.:::.|:.:...|::.|.|..|..|:..:...::.:.....|..:| 
  Fly   118 AFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFK 182

  Fly   187 --QSEINRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTD--EAKGIYIPFSSANLGMLILLPR 247
              |:.|..::|       ::.:...|.||...:|..:...|  :||.|.:|:.::.|.|.|:||.
  Fly   183 ADQTHIADFYV-------SANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPN 240

  Fly   248 KGVTCKDILDNLNNQIN-VEYN-DHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKA 310
            .    .|.|..|..::. ::|: :.|.|::.||.||.:....:...|..:.|.|.||.||     
  Fly   241 S----VDGLRKLKEKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSA----- 296

  Fly   311 KIKINNFRVNHGIRFQPIL-----------------------RLEVVDDIDTGKTETFEVNRPFV 352
              .:|...:..|.:...|:                       |.:.:|::.....| |..:.||.
  Fly   297 --DLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPME-FIADHPFF 358

  Fly   353 FVIKDKINVYAVGRI 367
            :||.|...:|..|.|
  Fly   359 YVIHDNKVIYFQGHI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 84/383 (22%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 84/393 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.