DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and serpinc1

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_878283.1 Gene:serpinc1 / 321545 ZFINID:ZDB-GENE-030131-264 Length:450 Species:Danio rerio


Alignment Length:377 Identity:73/377 - (19%)
Similarity:160/377 - (42%) Gaps:66/377 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEV----------LDWGLRYKK 93
            ||..||.::|..   .....|....|..||:.:.: |.:...:::.          |:..|..||
Zfish    89 ENIFLSPISIST---AFAMTKLGACNTTLEQLMKV-FQFDTIKEKTSDQVHFFFAKLNCRLYRKK 149

  Fly    94 ASSAKFQMANKVAVSQKLPLSQKLRLVNEVLMTSAK--KYDVTKDVRPSKL-MDEWLSSHLDGVL 155
            ..:.:...||::...:....::..:.::|.:. .||  ..|..:....|:: ::||:::..:..:
Zfish   150 HETTELISANRLFGDKSTTFNETFQHISETVY-GAKLMPLDFKEKPEASRITINEWIANKTENRI 213

  Fly   156 ANFVQEKKLNAGENIVAISGMTVTPLWASHF--QSEINRYFVNNPGTGYASKDPTCVPMMHSLSS 218
            .:.:.|..::....:|.::.:.....|.:.|  |:.:...|..:|    ..|.|  ||||:....
Zfish   214 KDTLPEGSIDTNTILVLVNAIYFKGQWKNKFDKQNVMKLDFHVSP----THKCP--VPMMYQEKK 272

  Fly   219 FE--TMSTDEAKGIYIPFSSANLGMLILLPRKGVTCKDILDNLNNQINVEY---NDHKDVHLLLP 278
            |:  .:..|:.|.:.:|::..::.|:::||.:|.|..:::.|:|.:..|.:   .....|.:.:|
Zfish   273 FQYAKIPEDKVKILELPYNGGDITMVLILPIEGATLSEVVANMNLKKLVGWLHAMKETTVAVQIP 337

  Fly   279 IFKEKFDYNIAKFFNGINIEDTFK---------------DSAFKS----KAKIKINNFRVNHGIR 324
            .|:.:..:::.:....:.:||.|.               .:.|.|    ||.:::|    ..|..
Zfish   338 RFRVEDSFSLKEQLTKMGLEDLFSPANASLPGMVADAEGPNLFISDAYHKAFLEVN----EEGSE 398

  Fly   325 FQPILRLEVVDDIDTGKT-----ETFEVNRPF-VFVIKDKIN-VYAVGRIEN 369
            ......:     :.||::     |.|..:||| :|:.:..|| :...||:.|
Zfish   399 ASAATAV-----VATGRSLNIFREQFVADRPFLLFIRESSINALIFTGRVAN 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 71/373 (19%)
serpinc1NP_878283.1 antithrombin-III_like 62..443 CDD:239000 71/373 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.