DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpine2

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_062070.1 Gene:Serpine2 / 29366 RGDID:3748 Length:397 Species:Rattus norvegicus


Alignment Length:407 Identity:92/407 - (22%)
Similarity:154/407 - (37%) Gaps:90/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLVLCTSLLFQNTIQQN----------VSFQLIREIDRYTP-ENFVLSVLNIEMILFEIHAAKAV 61
            |.:|.|..|.....|.|          ...|:..:|.:..| ||.|:|...|..||.        
  Rat     7 FFILTTVTLSSVYSQLNSLSLEELGSDTGIQVFNQIIKSQPHENVVISPHGIASILG-------- 63

  Fly    62 ESNNDLERSLIINFGYSEARQEVLDWGLRYKKASSAK-FQMANKVAVSQKLPLSQKLRLVNEVLM 125
                      ::..|.....::.|...:||......| .:..||..||:|  ....:.:.|.|.:
  Rat    64 ----------MLQLGADGRTKKQLSTVMRYNVNGVGKVLKKINKAIVSKK--NKDIVTVANAVFV 116

  Fly   126 TSAKKYDV-----TKDV-----------RPSKLMDE---WLSSHLDGVLANFVQEKKLNAG-ENI 170
            .:..|.:|     .|:|           .|:...|.   |:.:...|::.|.:....:::. ..:
  Rat   117 RNGFKVEVPFAARNKEVFQCEVQSVNFQDPASACDAINFWVKNETRGMIDNLLSPNLIDSALTKL 181

  Fly   171 VAISGMTVTPLWASHFQSE--INRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDEAKGIY-- 231
            |.::.:....||.|.||.|  ..|.||...|..|.      |||:..||.|.:.||....|::  
  Rat   182 VLVNAVYFKGLWKSRFQPENTKKRTFVAGDGKSYQ------VPMLAQLSVFRSGSTKTPNGLWYN 240

  Fly   232 ---IPFSSANLGMLILLPRKGVT-CKDILDNLNNQ-INVEYND--HKDVHLLLPIFKEKFDYNIA 289
               :|:...::.|||.||.:..| ...|:.:::.: ||...|.  .|.:.|:||.|......::.
  Rat   241 FIELPYHGESISMLIALPTESSTPLSAIIPHISTKTINSWMNTMVPKRMQLVLPKFTAVAQTDLK 305

  Fly   290 KFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQPIL---RLEVVDD------------IDT 339
            :....:.|.:.|:.|........:..:..|:|      ||   ::||.:|            |..
  Rat   306 EPLKALGITEMFEPSKANFAKITRSESLHVSH------ILQKAKIEVSEDGTKAAVVTTAILIAR 364

  Fly   340 GKTETFEVNRPFVFVIK 356
            .....|.|:|||:|.|:
  Rat   365 SSPPWFIVDRPFLFCIR 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 88/393 (22%)
Serpine2NP_062070.1 serpinE2_GDN 21..395 CDD:381039 88/393 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.