DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb1a

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001026812.1 Gene:Serpinb1a / 291091 RGDID:1306203 Length:379 Species:Rattus norvegicus


Alignment Length:323 Identity:66/323 - (20%)
Similarity:122/323 - (37%) Gaps:66/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 AKFQMAN----KVAVSQKLPLSQKL------RLVNEVLMTSAKKY----------DVTKDVRPSK 141
            ::||..|    |...|..|.|:.:|      ..:.|.|.::.|.|          ..::|.|  |
  Rat    68 SRFQSLNAEVSKRGASHTLKLANRLYGEKTYNFLPEFLTSTQKMYGADLAPVDFQHASEDAR--K 130

  Fly   142 LMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHF--QSEINRYFVNNPGTGYAS 204
            .:::|:....:|.:...:....:::...:|.::.:....:|...|  |...:..|..|      .
  Rat   131 EINQWVKGQTEGKIPELLAVGVVDSMTKLVLVNAIYFKGMWEEKFMKQDTTDAPFRLN------K 189

  Fly   205 KDPTCVPMMHSLSS--FETMSTDEAKGIYIPFSSANLGMLILLPR---------KGVTCKDILDN 258
            |:...|.||:....  |..:|..:.|.:.:|:....|.|:||||.         |.:..:..|:.
  Rat   190 KNTKSVKMMYQKKKFFFGYISDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEEQITLEK 254

  Fly   259 LNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGI 323
            |......|..::.|||:.||.||.:..|.:......:.::|.|..|      |..::....:..:
  Rat   255 LREWTKRENLENIDVHVKLPRFKIEESYILNSNLGRLGLQDLFNSS------KADLSGMSGSRDL 313

  Fly   324 RFQPILRLEVVDDIDTG-----------------KTETFEVNRPFVFVIKDK--INVYAVGRI 367
            ....|:....|:..:.|                 ..|.|..:.||:|.|:..  .||..:||:
  Rat   314 FISKIVHKAFVEVNEEGTEAAAATAGIATFCMLLPEEEFTADHPFIFFIRHNPTANVLFLGRV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 65/321 (20%)
Serpinb1aNP_001026812.1 SERPIN 4..379 CDD:294093 66/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.