DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb6a

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006253933.1 Gene:Serpinb6a / 291085 RGDID:735108 Length:400 Species:Rattus norvegicus


Alignment Length:370 Identity:68/370 - (18%)
Similarity:142/370 - (38%) Gaps:57/370 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SFQLIREIDRYTPENFVLSVLNIEMILFEIH-AAKAVESNNDLERSLI----------INFGYSE 79
            :.:|::.:...:..|..||.::|...|..:. .||.:.::..::...:          ::.|:..
  Rat    33 ALKLLKTLSEDSSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSLDKCSGNGGGDVHQGFQS 97

  Fly    80 ARQEVLDWGLRY--KKASSAKFQMANKVAVSQKLPLSQKLRLVNEVLMTSAKKYDVTKDVRPSK- 141
            ...||...|.:|  |.|:....:....:..|.|    ...|...|..|   ::.|...|...|: 
  Rat    98 LLAEVNKTGTQYLLKTANRLFGEKTCDILASFK----DACRKFYEAEM---EELDFKGDTEQSRQ 155

  Fly   142 LMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYFVNNP-GTGYASK 205
            .::.|::...:..:...:....::....:|.::.:.....|...|..|..|   ..| ......:
  Rat   156 RINTWVAKKTEDKIKELLAPGIVDPDTVLVLVNAIYFKGNWDKQFNKEHTR---EKPFKVSKTEE 217

  Fly   206 DPTCVPMMHSLSSFETMSTDE--AKGIYIPFSSANLGMLILLPRKGVTCKDILDNLNNQINVEYN 268
            .|  |.||...|:|:.....|  .|.:.:|::...|.|:|:||.:.:..|.:...|..:..:|:.
  Rat   218 KP--VQMMFMKSTFKMTYIGEIFTKILLLPYAGNELNMIIMLPDEHIELKTVEKELTYEKFIEWT 280

  Fly   269 -----DHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQPI 328
                 |.::|.:.||.||.:.:|::......:.:.|.|.:      .:...:......|:....:
  Rat   281 RLDMLDEEEVEVFLPRFKLEENYDMKVVLGKLGMTDAFME------GRADFSGIASKQGLFLSKV 339

  Fly   329 LR---LEVVDD-----IDTGKTET---------FEVNRPFVFVIK 356
            :.   :||.::     ..||.|.|         |..:.||:|.|:
  Rat   340 IHKAFVEVNEEGTEAVAATGSTITMRCLRFTPRFLADHPFLFFIQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 68/370 (18%)
Serpinb6aXP_006253933.1 SERPIN 25..400 CDD:294093 68/370 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.