DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb1b

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_766640.1 Gene:Serpinb1b / 282663 MGIID:2445361 Length:382 Species:Mus musculus


Alignment Length:322 Identity:68/322 - (21%)
Similarity:124/322 - (38%) Gaps:77/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 NKVAVSQKLPLSQKL------RLVNEVLMTSAKKYD----------VTKDVRPSKLMDEWLSSHL 151
            :|:..|..|.|:.:|      ..:.|.|.::.|.|.          .::|.|  |.:::|:....
Mouse    78 SKLGASHTLKLANRLYGEKTYNFLPEFLASTQKMYSADLAAVDFQHASEDAR--KEINQWVKGQT 140

  Fly   152 DGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSE--INRYFVNNPGTGYASKDPTCVPMMH 214
            :|.:...:.:..:::...:|.::.:....:|...|.:.  ||..|..|      .||...|.||:
Mouse   141 EGKIPELLAKGVVDSMTKLVLVNAIYFKGIWEEQFMTRETINAPFRLN------KKDTKTVKMMY 199

  Fly   215 SLSSFE--TMSTDEAKGIYIPFSSANLGMLILLPRKGVTCKDI------LDNLNNQINV----EY 267
            ....|.  .:|..:.|.:.:|:....|.|:||||      :||      |..:..|:.:    |:
Mouse   200 QKKKFPFGYISDLKCKVLEMPYQGGELSMVILLP------EDIEDESTGLKKIEEQLTLGKLHEW 258

  Fly   268 NDHK-----DVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQP 327
            ..|:     |||:.||.||.:..|.:......:.::|.|      |..|..::....:..:....
Mouse   259 TKHENLRNIDVHVKLPRFKMEESYILNSNLCCLGVQDLF------SSGKADLSGMSGSRDLFVSK 317

  Fly   328 ILRLEVVDDIDTG--------------------KTETFEVNRPFVFVIKDK--INVYAVGRI 367
            |:....||..:.|                    ..|.|.|:.||:|.|:..  .|:...||:
Mouse   318 IVHKSFVDVNEQGTEAAAATGGIIQVLCEKMPTPQEVFTVDHPFLFFIRHNPTANMIFFGRV 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 67/320 (21%)
Serpinb1bNP_766640.1 serpinB1_LEI 1..382 CDD:381028 68/322 (21%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 352..382 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.