DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb9c

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:397 Identity:77/397 - (19%)
Similarity:142/397 - (35%) Gaps:84/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FQNTI-QQNVSF--QLIREIDRYTP-ENFVLSVLNIEMIL----------FEIHAAKAVESNN-- 65
            |.|.: :.|.:|  .|:|.:....| :|...|.:||...|          .||..::|:..|.  
Mouse    27 FLNIVYEANGTFAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGLNTAI 91

  Fly    66 DLERSLIINFGYSEARQEVLDWGLRYKKASSAK--FQMANKVAVSQ--------KLPLSQKLRLV 120
            |:.:|.:              |.|...|..:.|  |:|||::....        |.|..|.....
Mouse    92 DIHQSFL--------------WILNILKKPTRKYTFRMANRLFAENTCEFLPTFKEPCLQFYHWE 142

  Fly   121 NEVLMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASH 185
            .|.|..:....:....:      :.|:..:..|.:...:....:::...:|.::.:.....|...
Mouse   143 MEHLPFTKAPEEARNHI------NTWVCKNTKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQ 201

  Fly   186 FQSEINR---YFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDE--AKGIYIPFSSANLGMLILL 245
            |..:..|   :.:|       ..:...|.||.....|:....:|  .:.:.:|:....|.:::||
Mouse   202 FDIKSTRKMPFKIN-------KDEERPVQMMFQEDMFKLAYVNEVQVQVLVLPYKGKELSLVVLL 259

  Fly   246 PRKGVTCKDILDNLNNQ-----INVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKD-- 303
            |..||....:..||..:     ...:|.....|.:.||.||.:..|::...|..:.:.|.|:.  
Mouse   260 PDDGVELSKVEGNLTFEKLSAWTKPDYLKTTKVLVFLPKFKLEDYYDMESIFQDLGVGDIFQGGK 324

  Fly   304 --------------SAFKSKAKIKINNFRVNHGIRFQPILRLEVVDDIDTGKTETFEVNRPFVFV 354
                          |.|..|..:::|    ..|.........:.|...:|...:||..:.||:|.
Mouse   325 ADLSEMSPERGLCVSKFIQKCVVEVN----EEGTEATAATADDTVCSAETHDGQTFCADHPFLFF 385

  Fly   355 IK-DKIN 360
            |: :|.|
Mouse   386 IRHNKTN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 75/391 (19%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 76/396 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.