DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and SERPINB1

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:383 Identity:77/383 - (20%)
Similarity:134/383 - (34%) Gaps:81/383 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FEIHAAKAVESNNDLERSLIINFGYSEARQEVLDWGLRYKKASS--------------AKFQM-- 101
            |.:....|:..||......|..|..|.|...|. .|.|...|:.              ::||.  
Human    11 FALDLFLALSENNPAGNIFISPFSISSAMAMVF-LGTRGNTAAQLSKTFHFNTVEEVHSRFQSLN 74

  Fly   102 --ANKVAVSQKLPLSQKL------RLVNEVLMTSAKKY----------DVTKDVRPSKLMDEWLS 148
              .||...|..|.|:.:|      ..:.|.|:::.|.|          ..::|.|  |.:::|:.
Human    75 ADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDAR--KTINQWVK 137

  Fly   149 SHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSE--INRYFVNNPGTGYASKDPTCVP 211
            ...:|.:...:....::....:|.::.:.....|...|..|  .|..|..|      .||...|.
Human   138 GQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLN------KKDRKTVK 196

  Fly   212 MMHSLSSFETMSTDEAK--GIYIPFSSANLGMLILLP---------RKGVTCKDILDNLNNQINV 265
            ||:....|.....::.|  .:.:|:....|.|:||||         .|.:..:..|:.|:.....
Human   197 MMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKP 261

  Fly   266 EYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQPILR 330
            |..|..:|::.||.||.:..|.:......:.::|.|..|      |..::.......|....|:.
Human   262 ENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS------KADLSGMSGARDIFISKIVH 320

  Fly   331 LEVVDDIDTG-----------------KTETFEVNRPFVFVIKDKI--NVYAVGRIEN 369
            ...|:..:.|                 ..|.|..:.||:|.|:...  ::..:||..:
Human   321 KSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPFLFFIRHNSSGSILFLGRFSS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 76/379 (20%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 77/383 (20%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.