DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinf2

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:376 Identity:68/376 - (18%)
Similarity:147/376 - (39%) Gaps:67/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FQLIREIDRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEVLDWGLRY 91
            |.|:.:..  |..|.|||.|::.:.|..:......::.:.|.|.|.:|.|  .....:|..  .|
Mouse    94 FSLVAQTS--TSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTG--SCLPHLLSH--FY 152

  Fly    92 KKASSAKFQMANKVAVSQKLPL-------SQKLRLVNEVLMTSAKKYDVTKDVRPSKLMDEWLSS 149
            :.......::|.::.:.:..|:       |::|.....|.:|..::.|:..       :::|:..
Mouse   153 QNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLTGKQEEDLAN-------INQWVKE 210

  Fly   150 HLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYFVNNPGTGYASKD-------- 206
            ..:|.:.:|:.|  |.....::.::.:.....|.:.|...:.:            ||        
Mouse   211 ATEGKIEDFLSE--LPDSTVLLLLNAIHFHGFWRTKFDPSLTQ------------KDFFHLDERF 261

  Fly   207 PTCVPMMHSLS---SFETMSTDEAKGIYIPFSSANLGMLILLPRK-GVTCKDILDNLNNQINVEY 267
            ...|.|||::|   .:..:...|.:..:.||.: |:..::::|.. .....::|.||.  .:..|
Mouse   262 TVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFKN-NMSFVVVMPTYFEWNVSEVLANLT--WDTLY 323

  Fly   268 N---DHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQPIL 329
            :   ..:...:.||....:...::....:.:.:::.|:....:.   |...|..|: .::.|..:
Mouse   324 HPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQGPDLRG---ISEQNLVVS-SVQHQSTM 384

  Fly   330 RLEVVDDIDTGKT---------ETFEVNRPFV-FVIKDKINV-YAVGRIEN 369
            .|..........|         .:|.|||||: |:::|.|.| ..||.:.|
Mouse   385 ELSEAGVEAAAATSVAMNRMSLSSFTVNRPFLFFIMEDTIGVPLFVGSVRN 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 67/372 (18%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 67/372 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.