DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb2

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001167641.1 Gene:Serpinb2 / 18788 MGIID:97609 Length:415 Species:Mus musculus


Alignment Length:406 Identity:81/406 - (19%)
Similarity:141/406 - (34%) Gaps:95/406 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NTIQQNVSFQLIREIDRY-----TPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYS 78
            ||.||........||..|     .||||           .....|:.::..|.....|....|  
Mouse    49 NTEQQMAKVLQFNEIGSYGITTRNPENF-----------SGCDFAQQIQKENYPSAILQAQAG-- 100

  Fly    79 EARQEVLDWGLRYKKASSAKFQMANKVAVSQ---------KLPLSQKLRLVNEVLMTSAKKYDVT 134
                         .|..||...:::.:...|         ||...:..|...|.:..|.|.|...
Mouse   101 -------------DKIHSAFSSLSSTINTPQGDYLLESANKLFGEKSARFKEEYIQLSKKYYSTE 152

  Fly   135 KDV--------RPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEIN 191
            .:.        ...:.::.|:.:...|.:.|.:.|..::....:|.::.:.....|.:.|:.::|
Mouse   153 PEAVDFLECAEEAREKINSWVKTQTKGEIPNLLPEGSVDEDTKMVLVNAVYFKGKWKTPFEKKLN 217

  Fly   192 RYF---VNNPGTGYASKDPTCVPMM--HSLSSFETMSTDEAKGIYIPFSSANLGMLILLP---RK 248
            ..:   ||       |.:...|.||  |:..:...:...:.:.:.:| .:.|:.||:|||   ..
Mouse   218 GLYPFRVN-------SHESIPVQMMFLHAKLNIGYIKDLKTQILELP-HTGNISMLLLLPDEIED 274

  Fly   249 GVTCKDILD------NLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFK 307
            ..|..::|:      |.|..|:.:..|..||.:.:|.||....|.:......:.:||.|      
Mouse   275 ASTGLELLESEINFANFNKWISKDTLDEDDVVVYIPKFKLAQSYELKSILQSMGMEDAF------ 333

  Fly   308 SKAKIKINNFRVNHGIRFQPILRLEVVD-------------DIDTGKT----ETFEVNRPFVFVI 355
            :|.|...:.....:.:....:.....||             .:.||:|    ..|..:.||:|.|
Mouse   334 NKGKANFSGMSERNDLFLSEVFHQASVDVTEEGTVAAGGTGAVMTGRTGHGGPQFVADHPFLFFI 398

  Fly   356 KDKI--NVYAVGRIEN 369
            .|||  .:..|||..:
Mouse   399 MDKITHTILFVGRFSS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 78/399 (20%)
Serpinb2NP_001167641.1 SERPIN 4..415 CDD:294093 81/406 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.