DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and srp-1

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_503315.1 Gene:srp-1 / 178585 WormBaseID:WBGene00005642 Length:366 Species:Caenorhabditis elegans


Alignment Length:375 Identity:77/375 - (20%)
Similarity:145/375 - (38%) Gaps:53/375 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLLFQNTIQQNVSFQLIREI--DRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFG 76
            ||:.....:.....:|:.::  |:.||  .|.|.::|.:.|..:|......:.:|: |:.::|..
 Worm     4 SLINSTFTEAQFGIKLLSDLTSDQLTP--CVFSPVSILLSLALVHLGAKGHTRHDI-RNSVVNGS 65

  Fly    77 YSEARQEVLDW--GLRYKKASSAKFQMANKVAVSQKLPL----SQKLRLVNEVLMTSAKKYDVTK 135
            ..|...|...:  .|.....:..:..:||::.||.:..:    :.:||   |.........|..|
 Worm    66 TDEQFIEHFSFINKLLNSSVNDVETLIANRLFVSPEQAIRKAFTDELR---EHYNAETATIDFKK 127

  Fly   136 DVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYFVNNPGT 200
            ....:|:|::::|....|.:.:.::.      :|:..:..:.:..::   ||.:..|.| ..|..
 Worm   128 SQEAAKIMNQFISESTKGKIPDMIKP------DNLKDVDAILINAIF---FQGDWRRKF-GEPAE 182

  Fly   201 GYASKDPT---CVPMMHSLSSFETMSTDEAKGIYIPFSSANLGMLILLPRKGVTCKDILDNLN-- 260
            ...|...|   .|||:.....:.....||.:.|.|||...:....|.||.:.....:.|.:||  
 Worm   183 SNFSISATENRLVPMLRETRDYFYNKDDEWQVIGIPFKDKSAWFAIFLPTRRFALAENLKSLNAA 247

  Fly   261 ---NQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHG 322
               |.||..|.::  :.|..|.||..:..|:........:.:.|.:.|..|.....:......| 
 Worm   248 KFHNLINNVYQEY--IFLTFPKFKMDYKINLKTALAKFGLAELFTEQADLSGIGPGLQLASATH- 309

  Fly   323 IRFQPILRLEVVDDIDTGKTET--------------FEVNRPFVF-VIKD 357
               |.::.::.|.......||.              ..|:.||:| :|||
 Worm   310 ---QALIEVDQVGTRAAAATEAKIFFTSASSDEPLHIRVDHPFLFAIIKD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 75/367 (20%)
srp-1NP_503315.1 serpinL_nematode 11..365 CDD:381047 75/368 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.