DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinc1

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_543120.1 Gene:Serpinc1 / 11905 MGIID:88095 Length:465 Species:Mus musculus


Alignment Length:380 Identity:74/380 - (19%)
Similarity:159/380 - (41%) Gaps:74/380 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEVLD--------WGLR-YKKA 94
            :|..||.|:|....    |...:.:.||..:.|:..|.:....::..|        ...| |:||
Mouse   107 DNIFLSPLSISTAF----AMTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKA 167

  Fly    95 S-SAKFQMANKVAVSQKLPLSQKLRLVNEVLM-TSAKKYDVTKDVRPSKL-MDEWLSSHLDGVLA 156
            : |:....||::...:.|..::..:.|:||:. ...:..|..::...|:: ::.|:::..:|.:.
Mouse   168 NKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKENPEQSRVTINNWVANKTEGRIK 232

  Fly   157 NFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYFVNNPGTGYASKDP-------TC-VPMM 213
            :.:.:..:|....:|.::.:....||.|.|..|..|            |:|       :| ||||
Mouse   233 DVIPQGAINELTALVLVNTIYFKGLWKSKFSPENTR------------KEPFYKVDGQSCPVPMM 285

  Fly   214 HSLSSFETMSTDEAKGIY-IPFSSANLGMLILLPRKGVTCKDILDNLNNQINVEYNDHKDVHLL- 276
            :....|:.....|...:. :||...::.|:::||:...:...:...|..::..|:.|.....:| 
Mouse   286 YQEGKFKYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEWLDELSETMLV 350

  Fly   277 --LPIFKEKFDYNIAKFFNGINIEDTF--------------KDSAFKS----KAKIKINNFRVNH 321
              :|.|:.:..:::.:....:.:.|.|              :|..:.|    ||.:::|......
Mouse   351 VHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPGIVAGGRDDLYVSDAFHKAFLEVNEEGSEA 415

  Fly   322 GIRFQPILRLEVVDDIDTGKT-----ETFEVNRPFVFVIKD-KIN-VYAVGRIEN 369
            ......::         ||::     .||:.||||:.:|:: .:| :..:||:.|
Mouse   416 AASTSVVI---------TGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVAN 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 72/376 (19%)
Serpinc1NP_543120.1 serpinC1_AT3 71..464 CDD:381002 74/380 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.