DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb5

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_476449.2 Gene:Serpinb5 / 116589 RGDID:69342 Length:375 Species:Rattus norvegicus


Alignment Length:405 Identity:87/405 - (21%)
Similarity:152/405 - (37%) Gaps:97/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NVSF--QLIREIDRYTPENFVL---SVLNIEMILFEIHAAKAVESNN-----DLERSLIINFGYS 78
            |.:|  :|.:::....|...:|   ..|:..:.|.:: .||...:|.     ..|....:.||:.
  Rat     8 NSAFAVELFKQLCEKEPAGNILFSPICLSTSLSLAQV-GAKGDTANEIGQVLHFENVKDVPFGFQ 71

  Fly    79 EARQEVLDWGLRYKKASSAKFQMANKVAVSQKLPL------SQKLRLVNEVLMTSAK-KYDVTKD 136
            ....:|      .|.:|....::..::.:.:.|.|      |.|....||:.....| |.:.||.
  Rat    72 TITSDV------NKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELETVDFKDKLEETKG 130

  Fly   137 VRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHF-QSEINR--YFVNNP 198
            ...|.: .|....|.:.:|    .|..::....|:.::.......|...| :||...  :.:|  
  Rat   131 QINSSI-KELTDGHFEDIL----PENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRIN-- 188

  Fly   199 GTGYASKDPTCVPMMHSLSSFETMSTDE--AKGIYIPFSSANLGMLILLPRKGVTCKDI------ 255
                 ..|...|.||:..::|...:.|:  .|.|.:||.:.:|.|||:||      ||:      
  Rat   189 -----KTDTKPVQMMNLEATFCLGNIDDINCKIIELPFQNKHLSMLIVLP------KDVEDESTG 242

  Fly   256 LDNLNNQINVE---------YNDHKDVHLLLPIFK-EKF--------DYNIAKFFNGINIEDTFK 302
            |:.:..|:|.|         ...:..|.|.||.|| ||.        ...:...||    |.|..
  Rat   243 LEKIEKQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFN----ESTSD 303

  Fly   303 DSAFKSKAKIKINNFRVNHGIRFQPILRLEVVDD-----------IDTGKTETFEVNRPFVFVIK 356
            .|.......:.::|  |.|.:      .||:.:|           |...|.| |:.:.||:|:::
  Rat   304 FSGMSETKGVSVSN--VIHRV------CLEITEDGGDSIEVPGSRILQHKDE-FKADHPFLFIVR 359

  Fly   357 DK--INVYAVGRIEN 369
            ..  .|:..:|:..:
  Rat   360 HNKTRNIVFLGKFSS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 87/401 (22%)
Serpinb5NP_476449.2 serpinB5_maspin 1..375 CDD:381013 87/405 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.