DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and serpine1

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:393 Identity:82/393 - (20%)
Similarity:158/393 - (40%) Gaps:64/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIFLVLCTSLLFQNTIQQ---NVSFQLIREIDRYTPE-NFVLSVLNIEMILFEIHAAKAVESNND 66
            ::...||.|.|. |.||.   :...|:..|..:..|: |..||...|..:|    ....:.:...
Zfish     7 LLIFALCASSLC-NLIQDKQTDFGLQVFAEAVQSAPDRNLALSPYGIASVL----GMAQMGAYGA 66

  Fly    67 LERSLIINFGYS--EARQEVLDWGLRYKKASSAKFQMANKVAVSQKLPLSQKL-RLVNEVLMTSA 128
            ..:.|....|||  |.....|...|:...||....::|:.|.|.:|:.|.:.. |.:::...:..
Zfish    67 TLKLLASKMGYSLQERGMPKLQRLLQRDLASEDGVEVASGVMVDRKIILEKVFRRSLSKAFQSVP 131

  Fly   129 KKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRY 193
            .:.|.::.....::::.|.|.|.||:::.|:....|:....:|.::.:....:|.:.|.....|.
Zfish   132 HQIDFSQPEMARQVINSWTSDHTDGMISEFLPSGVLSELTRLVFLNALHFHGVWKTPFDPRNTRE 196

  Fly   194 FVNNPGTGYASKDPTCVPMMHSLSSF---ETMSTD--EAKGIYIPFSSANLGMLILLPRKGVTCK 253
            .:.:...|.|    ..||||.:...|   |.:|.|  :...|.:|:...::.||::.|.:    |
Zfish   197 QLFHTVNGSA----VSVPMMTTTQKFNYGEFVSKDGVDYDVIEMPYEGESISMLLVTPFE----K 253

  Fly   254 DI-LDNLNNQINVEYNDHKDVH------------LLLPIFKEKFDYNIAKFFNGINIEDTFKDSA 305
            |: |..||.:::     ...:|            |.:|.|....:.::....:.:.:.|.|    
Zfish   254 DVPLSALNKELS-----SSRIHQWRQEMRKISKQLSIPRFSMDTEIDLKSTLSRMGLGDIF---- 309

  Fly   306 FKSKAKIKINNFRVNHGIRFQPIL---RLEVVDDIDTGKTETFEV------------NRPFVFVI 355
              |:::...:.......:....:|   :|||.::...|.:.|..|            :|||.|:|
Zfish   310 --SQSRADFSRITTEEPLCVSKVLQRVKLEVNEEGTKGSSATAAVIYSRMAVEEITLDRPFFFLI 372

  Fly   356 KDK 358
            :.|
Zfish   373 QHK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 76/377 (20%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 75/373 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.