DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and ZMYND12

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_115633.3 Gene:ZMYND12 / 84217 HGNCID:21192 Length:365 Species:Homo sapiens


Alignment Length:378 Identity:80/378 - (21%)
Similarity:125/378 - (33%) Gaps:119/378 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQ-------------------------- 47
            |.:|:|.|.::||||....||...|||..|...|...||                          
Human    17 CEVCEAPAERVCAACTVTYYCGVVHQKADWDSIHEKICQLLIPLRTSMPFYNSEEERQHGLQQLQ 81

  Fly    48 ---------CFEIATNEVL-GRH-------LRATR-----------DIKIGEQILKEAPLVLGPK 84
                     |:.||...:. |:|       |::.|           ::.....:|.||.|.|| :
Human    82 QRQKYLIEFCYTIAQKYLFEGKHEDAVPAALQSLRFRVKLYGLSSVELVPAYLLLAEASLGLG-R 145

  Fly    85 VASAPLCLGCHRNLLAPGKPRGNYHKCSSCSWP-LCGKECEDSVHHKAECQLMSGSNFQSKINYV 148
            :..|...|                   ....|. |...:|.::.|......|  |..:.:|.|| 
Human   146 IVQAEEYL-------------------FQAQWTVLKSTDCSNATHSLLHRNL--GLLYIAKKNY- 188

  Fly   149 PGEEERKESAYCVIMLLRCMHLKD-KDPDAFLKLYNLEDHLK-----ERLETPLYQVLRANLITF 207
              ||.|...|..:.........:| :....:..|.|:...||     :.|.|.:.::..|.|...
Human   189 --EEARYHLANDIYFASCAFGTEDIRTSGGYFHLANIFYDLKKLDLADTLYTKVSEIWHAYLNNH 251

  Fly   208 IKTVLGMKDWPEMDILRIAAILDTNTFEVRQPRERRKIRALYPGAAMISHDCVPNMRHRFDD--D 270
            .: ||......:||:|   ..|..|...:.:.:|...||.|         ..:.|:|....|  .
Human   252 YQ-VLSQAHIQQMDLL---GKLFENDTGLDEAQEAEAIRIL---------TSILNIRESTSDKAP 303

  Fly   271 MNIVFLAKRKI---------AKGE-----ILSISYTQPL----RSTIQRRVHL 305
            ...:|:.|..:         :|.:     .||::..|.|    :||||..:.|
Human   304 QKTIFVLKILVMFYYLMMNSSKAQEYGMRALSLAKEQQLDVHEQSTIQELLSL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 15/36 (42%)
SET <246..291 CDD:214614 10/60 (17%)
ZMYND12NP_115633.3 zf-MYND 17..54 CDD:280009 15/36 (42%)
TPR repeat 88..116 CDD:276809 6/27 (22%)
TPR_12 92..156 CDD:290160 14/83 (17%)
TPR repeat 129..167 CDD:276809 10/57 (18%)
TPR 1 172..205 9/37 (24%)
TPR repeat 172..195 CDD:276809 8/27 (30%)
TPR_12 174..243 CDD:290160 16/73 (22%)
TPR 2 214..247 6/32 (19%)
TPR repeat 214..242 CDD:276809 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.