DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and AT1G26761

DIOPT Version :10

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001117357.1 Gene:AT1G26761 / 6241260 AraportID:AT1G26761 Length:444 Species:Arabidopsis thaliana


Alignment Length:65 Identity:17/65 - (26%)
Similarity:27/65 - (41%) Gaps:8/65 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 ILSISYT-QPLR--STIQRR---VHLRQAKCFDCSCARCQDPEELGSFAGAQTCLKCKAGKIISL 344
            |::.|.| ||.|  ||:..|   ...::...|..:..||...:  ...||..:.:..|.|.:..|
plant    10 IVTASRTVQPYRRLSTLSLRFPTYRNKRVSPFTLTITRCSTTK--SREAGQDSSISLKRGLVFDL 72

  Fly   345  344
            plant    73  72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:460312
SET_SMYD <227..318 CDD:380997 10/37 (27%)
AT1G26761NP_001117357.1 GH43_62_32_68_117_130 <99..>130 CDD:449341
GH43_62_32_68_117_130 202..430 CDD:449341
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.