DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Zmynd15

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001025100.1 Gene:Zmynd15 / 574428 MGIID:3603821 Length:736 Species:Mus musculus


Alignment Length:242 Identity:54/242 - (22%)
Similarity:85/242 - (35%) Gaps:64/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSLTSCALCQAKASQL----CAACRNVVYCSREHQKEHWKK-----GHRSEC---QCFEIATN 54
            ||....:|.:|...:.::    |..|..|:||.....:..|::     .||..|   ..|.....
Mouse   300 ASLRARTCHVCHKHSFEVKLTPCPQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLSAFMERVG 364

  Fly    55 EVLGRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLL----APGKPRGNYHKCSSCS 115
            |:.......|.:: ..|...|||.|      ||..|..|....|.    .||.||..:...||.|
Mouse   365 ELASLPFTYTAEV-TSETFNKEAFL------ASRGLTRGYWTQLSMLIPGPGAPRYPWGSTSSLS 422

  Fly   116 WPLCGKECEDSVHHKAECQLMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDPDAFLK 180
            ..|.|.          ..||:.|.. .:.:..||.|..|                         .
Mouse   423 CLLNGD----------PYQLLQGDG-PALMPPVPLEPPR-------------------------S 451

  Fly   181 LY-NLEDHLKER---LETPLYQVLRANL-ITFIKTVLGMKDWPEMDI 222
            |: :.:|:...|   |::|:..:|...| :.::.|.|..:.:||::|
Mouse   452 LFGSWQDYYTWRGLSLDSPMAVLLTYPLTVYYVITHLVPQSFPELNI 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 10/45 (22%)
SET <246..291 CDD:214614
Zmynd15NP_001025100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..192
zf-MYND 307..353 CDD:280009 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 696..736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.