DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and zmynd12

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001007305.1 Gene:zmynd12 / 492338 ZFINID:ZDB-GENE-041114-133 Length:365 Species:Danio rerio


Alignment Length:38 Identity:13/38 - (34%)
Similarity:17/38 - (44%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSEC 46
            |.:||..|...|..|....||:.:||:..|...|...|
Zfish    18 CEICQKPAKLQCTKCLVTFYCNLDHQQADWTSIHEKAC 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 12/36 (33%)
SET <246..291 CDD:214614
zmynd12NP_001007305.1 zf-MYND 18..55 CDD:280009 12/36 (33%)
TPR_12 168..240 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.