powered by:
Protein Alignment SmydA-2 and zmynd12
DIOPT Version :9
Sequence 1: | NP_649084.1 |
Gene: | SmydA-2 / 40075 |
FlyBaseID: | FBgn0036839 |
Length: | 530 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001007305.1 |
Gene: | zmynd12 / 492338 |
ZFINID: | ZDB-GENE-041114-133 |
Length: | 365 |
Species: | Danio rerio |
Alignment Length: | 38 |
Identity: | 13/38 - (34%) |
Similarity: | 17/38 - (44%) |
Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 CALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSEC 46
|.:||..|...|..|....||:.:||:..|...|...|
Zfish 18 CEICQKPAKLQCTKCLVTFYCNLDHQQADWTSIHEKAC 55
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.