DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and smyd5

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001004614.2 Gene:smyd5 / 447875 ZFINID:ZDB-GENE-040912-39 Length:415 Species:Danio rerio


Alignment Length:383 Identity:87/383 - (22%)
Similarity:137/383 - (35%) Gaps:112/383 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CFEIA-TNEVLGRHLRATRDIKIGEQILKEAPLVLGP-------KVASAPLCLGCHRN------- 97
            |.::. .|.|.|:.|.|.:..|.|:.|..|.|||...       |..:...||.....       
Zfish    21 CVDVRFINNVKGKGLFAKKPFKKGDTIFIERPLVSSQFLWNALYKYRACEYCLRALETAEENARR 85

  Fly    98 ------LLAPG----KPRGNYHK-CSSCSWPLCGKECEDSV---HHKAECQLMSGSNFQSKIN-- 146
                  |:.|.    |.|.:.|: |..|....|..||..:.   :||..|...|..:....:|  
Zfish    86 LSGLPALILPHPELCKVRPDRHQACPQCQVMYCSSECRQAAMDQYHKILCLGPSNDDPDHPVNKL 150

  Fly   147 -------YVPGEEERKESAYCVIMLLRCMHLKDKDPDAFLKLY--------NLEDHLKERLETPL 196
                   :.|.|    .|:..::..:.....:.:|.:.:.:|:        |.|:.:..:|....
Zfish   151 QDAWRSVHFPPE----TSSVMILAKMVATIKQTQDKERWQRLFTNFCSRTANEEEEIVHKLLGEK 211

  Fly   197 YQ----VLRANLITFIKTVLGMKDW--PEMDILRIAAILDTN-----TFEVRQ----------PR 240
            :|    :|| ||.|.......:..|  || ....:.:::.||     |..:.|          ||
Zfish   212 FQGQLGLLR-NLFTTALYEDRLSQWFTPE-GFRSLFSLVGTNGQGIGTSSLSQWVHACDALELPR 274

  Fly   241 ERRK-----IRALY-------------PGAAMI------SHDCVPNMRHRFDDDMNIVFL-AKRK 280
            ::|:     |..||             .|:.:.      :|.||||....|.::..::.| |...
Zfish   275 QQREQLDAFIDQLYKDIDKETGDFLNCEGSGLFLLQSSCNHSCVPNAEASFPENNFLLHLTALGD 339

  Fly   281 IAKGEILSISY---TQPLRSTIQRRVHLRQAKCFDCSCARC-----------QDPEEL 324
            |..||.:.|||   .|..||...|...||:...|.|||.:|           :|.||:
Zfish   340 IGPGEEICISYLDCCQRDRSRHSRHKILRENYLFICSCQKCLSQMDDADMTSEDEEEV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 15/64 (23%)
smyd5NP_001004614.2 zf-MYND 100..135 CDD:280009 10/34 (29%)
SET <293..350 CDD:214614 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.