DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Smyd5

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster


Alignment Length:384 Identity:85/384 - (22%)
Similarity:131/384 - (34%) Gaps:124/384 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FEIATNEVLGRHLRATRDIKIGEQILKEAPLV---LGPKVA-SAPLCLGCHRNL---------LA 100
            |||......||.:.||::....|.|.:|.|.|   ....|| ....|..|.|.|         ||
  Fly     4 FEIRELPGKGRAMIATKNFAKDEVIFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRLA 68

  Fly   101 PGKPR---------------GNYHKCSSCSWPLCGKEC---EDSVHHKAECQLMSGSNFQSKINY 147
             ..|:               ..:.:|..|....|.::|   ....:|:..|.....|:....||.
  Fly    69 -SDPKVEVPLLQHDPTAQWVAQFTQCPRCKVRYCSEDCLMEAQKRYHRVACMGAFHSDDTHPINV 132

  Fly   148 VPGEEERKESAY-----CVIMLLRCMHL--KDKDPDAFL---------------KLYN--LEDHL 188
            :  .|..|:..|     .:::::|.|.|  :....:.||               |:|:  |.::.
  Fly   133 L--NETWKKMHYPPETGSIMLIVRLMALYQQSTKKEEFLEQLQSFQSLIVNREQKIYHKMLGENF 195

  Fly   189 KERLETPLYQVLRANLITFIKTVLGMKDWPEMDILR-------IAAILDTNTFEVR--------- 237
            ::::| .||       :.|.....|    .|..|.:       :.|||.||:..:.         
  Fly   196 EQQME-QLY-------LAFCNAFTG----EEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVA 248

  Fly   238 -------QPRERRKI-----------------------RALYPGAAMISHDCVPNMRHRFDDDMN 272
                   ...|:.::                       ..||...:.|:|.||||....|....:
  Fly   249 KVSDLPLTDSEKEQLDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSND 313

  Fly   273 IVFL-AKRKIAKGEILSISYTQPL---RSTIQRRVHLRQAKCFDCSCARCQ----DPEE 323
            ||.| |...|.:||.:.|||....   ||...|...||:...|.|.|.:|:    ||:|
  Fly   314 IVVLKALAPIQQGEEICISYLDECMLERSRHSRHKVLRENYVFICQCPKCRAQASDPDE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 17/45 (38%)
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 5/30 (17%)
SET <296..333 CDD:279228 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.