DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Smyd4-4

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster


Alignment Length:461 Identity:104/461 - (22%)
Similarity:157/461 - (34%) Gaps:147/461 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CFEIATNEVLGRHLRATRDIKIGEQILKEAPLVLGPKVASAPL----CLGCHRNLLAPGKPRGNY 108
            |.|:......||.:...||:.:|:.:..|.|..   .....|:    |..|.|.         ||
  Fly   186 CLELRETAAEGRFVVTNRDLAVGDLVSVEEPFC---STLLTPMRYIRCATCKRE---------NY 238

  Fly   109 ---HKCSS-CSWPLCGKECED---SVHHKAECQLMSGSN--FQS-----------KINYVPGEEE 153
               ..|.| ||...|.:||:.   ..:|:.||.::...|  |..           .:|..|..||
  Fly   239 LTLIPCDSCCSTMFCSEECKSIAMQTYHRYECPIIDFLNRMFNKIHCIALRTTLVALNIFPSIEE 303

  Fly   154 RKESAYCVIMLLRCMHLKDKDPDAFLKLYN---LEDHLKE----------RLETPLYQ------V 199
                     ::..|...:::|..||...||   .|:|.:.          |..:.|:|      |
  Fly   304 ---------LIDFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLFQRSVVCAV 359

  Fly   200 LRANLITF--IKTVLGMKDWPEMDILRIAAILDTNTFE------VRQPRERRKIRALYPGA---- 252
            |:..:|.:  :|..||.::........:...|.|:...      |.|..|.:..:....||    
  Fly   360 LKHFIIEYTPVKEYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGAYAFL 424

  Fly   253 AMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQ--PLRSTIQRRVHLRQAKCFDCSC 315
            ::|:|.|.||....::.....:|:. |.|..|.:|..:|..  .:.|..||...|.....|||.|
  Fly   425 SLINHSCAPNTVRIYEGTKAYMFVL-RPIKAGNVLYDNYGAHFAICSKEQRLKRLSLQYRFDCKC 488

  Fly   316 ARCQDPEELGSFAGAQTCLKCKAGKIISLN-PLLNSAPWKCQLCNFKRSAKDVVTSDAELQQELE 379
            ..|:                        || |:....|.|..:.:        ||.|.||     
  Fly   489 EGCE------------------------LNYPMFGMMPHKATVPS--------VTDDTEL----- 516

  Fly   380 SLDKTTPVALEEFIYRHRADLHETNTHILQAKYA--LTQLYGSAPGFAMEELSGESLNRKLQLCE 442
                    ||..:.|    |...:|    ..||.  ||| ||.  .:..|::|.         .|
  Fly   517 --------ALSSYNY----DFAVSN----YRKYCDFLTQ-YGD--DYPCEQISS---------AE 553

  Fly   443 ELLKLA 448
            |.||:|
  Fly   554 ECLKMA 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 12/48 (25%)
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 13/48 (27%)
SET 363..463 CDD:279228 21/100 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.