DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Smyd4-3

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster


Alignment Length:482 Identity:115/482 - (23%)
Similarity:165/482 - (34%) Gaps:155/482 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IATNEVLGRHLRATRDIKIGEQILKEAPL--VLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSS 113
            |.:|...||..||:.|:|.||::|.|.|.  ||..|.|... |..|....:.|       ..|..
  Fly   243 IDSNRQEGRFARASADVKPGEELLVERPFVSVLLEKFAKTH-CENCFMRTVVP-------VACPR 299

  Fly   114 CSWPL-CGKECEDSV---HHKAECQLM-----SGSNFQSKINYVPGEEERKESAYCVIMLLRCMH 169
            |:..| |.::|.:..   :||.||.::     ||::..:.|                  .||.:.
  Fly   300 CADVLYCSEQCREEASKKYHKYECGIVPIIWRSGASINNHI------------------ALRIIA 346

  Fly   170 LKDKD----------------------PDAFLKLYNLEDHLKERLETPLYQ-VLRANLITFIKTV 211
            .|..|                      .|.|.::..||.|..||..:..:| ||.|..:|.....
  Fly   347 SKPLDYFLKLKPTIDEELTPEQLISLPKDDFRRVAQLERHQGERQPSNFFQHVLMARFLTNCLRA 411

  Fly   212 LG-MKDWPEMD--------ILRIAAILDTNTFEVRQ-------PRERRKI--RALYPGAAMISHD 258
            .| ....|:.|        :||....:..||.||.:       .||:...  .|:||..|:.:|.
  Fly   412 GGYFGSEPKPDEVSIICSLVLRSLQFIQFNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHS 476

  Fly   259 CVPNMRHRFDDDMNIVFLAKRKIAKG----EILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQ 319
            |.|.: .|:.....|...:.|.|..|    |.....|||..||  :|:..|:....|:|||..|.
  Fly   477 CDPGV-VRYFRGTTIHINSVRPIEAGLPINENYGPMYTQDERS--ERQARLKDLYWFECSCDACI 538

  Fly   320 D--------PEELGSFAGAQTCLKCKA----GKIISLNPLLNSAPWKCQLC----NFKRSAKDVV 368
            |        |.::..|       :|.|    ..:|.:.|..|....||..|    |..:..|   
  Fly   539 DNWPKFDDLPRDVIRF-------RCDAPNNCSAVIEVPPSCNDFMVKCVTCGEITNILKGLK--- 593

  Fly   369 TSDAELQQELESLDKTT---------PVALEEFIYRHRADLHETNTHILQAKYALTQLYGSAPGF 424
                 :.|:.|.:.:|.         |.||.:|:     ||......:|            ||.|
  Fly   594 -----VMQDTEMMTRTAKRLYETGEYPKALAKFV-----DLIRIMYEVL------------APPF 636

  Fly   425 AMEELSGESLNRKLQLCEELLKLADIF 451
            .             ..||....|.|.|
  Fly   637 P-------------DFCESQQHLKDCF 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 13/48 (27%)
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 10/45 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.