DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and dao

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001260462.1 Gene:dao / 34891 FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster


Alignment Length:634 Identity:127/634 - (20%)
Similarity:214/634 - (33%) Gaps:212/634 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSCALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQCFEIA--TNEVL----------- 57
            |.:.|||:....:|.....|.|:.:|.|  |.|.:....:.:.||:|  |.:.|           
  Fly   256 LRNFALCEEHLHELLHIELNQVFEARTH--ELWHQCEVLKVERFEMAVQTGDDLDINDSKAFEIA 318

  Fly    58 ----GRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSWPL 118
                ...|..||.:.....|.:...:.:.|. .:..:|..|......|       ..|..||..|
  Fly   319 WLDNSSSLHTTRAVAKNALIFESEAVAMVPS-GNCRVCDYCGITQFIP-------FPCIYCSNRL 375

  Fly   119 ---CGKEC--EDSVHHKAEC--------------------------QLMSG-------------- 138
               |.::|  :.:..|..||                          .|::|              
  Fly   376 VVYCSRQCRFKHAAIHAVECFGHQIELFESFGEVFGMPRLLQLAFRMLITGLPELLGHCRKKPTL 440

  Fly   139 SNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDP-DAFLKL----YNLEDHLKERLETPLYQ 198
            |...|.||  .|.:||::.||..:  ||...||::.| |..:.|    :.|..:|.:.  |..:.
  Fly   441 SKLWSAIN--GGLQERQDIAYSAV--LRLERLKEERPTDTVIALALAAHILSIYLSKC--TTFFD 499

  Fly   199 VLRANLITFIKTVLGMKDWPEMDILRIAAILDTNTFEVRQPRERRKIRALYPGAAMISHDCVPNM 263
            .|..:|.|..:  :...:|.    |..||:|..:..::|.       |:|....:.:    :|..
  Fly   500 QLEKSLPTASR--MSSAEWE----LLCAALLMRHIGQLRH-------RSLTACRSFV----LPAD 547

  Fly   264 RHRFD--DDMNIVFLAKR------KIAKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQD 320
            .|.|.  ::..:.....|      .:..||:..:||     |.....::|.:..|....||:   
  Fly   548 PHVFSPLNEFQLWAAPMRLQEGHLHLLAGEVAVVSY-----SVYPDTLNLCRHSCSSTICAK--- 604

  Fly   321 PEELGSFAG-AQTCL------------KCKAGKIISLNP-------LLNSAPWKCQLCNFKRSAK 365
                  |:| ..|.|            .|.||......|       ||.|. .:|. ||    |.
  Fly   605 ------FSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPREERTKQLLESG-IRCH-CN----AC 657

  Fly   366 DVVTSDAELQQELESLDKTTPVALEEFIYRHRAD------LHETNT--HILQAKYALTQLYGSAP 422
            .:..||.:..:                .:|:|.|      :...|.  |....::.|::.|    
  Fly   658 QLTHSDDQFHK----------------FHRYRCDNPNCMEIFTPNALPHAPSLRWWLSEEY---- 702

  Fly   423 GFAMEELSGESLNRKLQLCEELLKLADIFDGGWSIFRGNLLIDMEEALVTQALRSKDPLDC---E 484
              ...|.:|..| .....|.|..||    :..|:.              |.:|     :||   |
  Fly   703 --TQPEFNGADL-IMCPHCGEYQKL----EWFWAF--------------TTSL-----IDCELIE 741

  Fly   485 EKLRNAAEMLREIRNIMK-HEPE--MQQLLLERQVIL----SSALERFE 526
            |:.:..|.:.|....:|. ||.:  :.:||||:.:::    ::.|:.:|
  Fly   742 ERCKLYAAIERAENQLMDLHECKVALARLLLEQCLMVHREGATVLDDWE 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 10/36 (28%)
SET <246..291 CDD:214614 8/52 (15%)
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809 4/13 (31%)
zf-MYND 355..395 CDD:280009 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.