DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and LOC3291278

DIOPT Version :10

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_061513155.1 Gene:LOC3291278 / 3291278 VectorBaseID:AGAMI1_001906 Length:386 Species:Anopheles gambiae


Alignment Length:43 Identity:13/43 - (30%)
Similarity:20/43 - (46%) Gaps:7/43 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CALCQAKASQL-----CAACRNVVYCSREHQKEHWKKGHRSEC 46
            |..|.::  :|     |..|...::||.....|.::|.||.||
Mosquito   232 CNYCHSR--RLFTFIPCEGCTVAMFCSVACLTEAYRKYHRYEC 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:460312 11/41 (27%)
SET_SMYD <227..318 CDD:380997
LOC3291278XP_061513155.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.