DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and set5

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_588413.1 Gene:set5 / 2538853 PomBaseID:SPCC1739.05 Length:319 Species:Schizosaccharomyces pombe


Alignment Length:241 Identity:55/241 - (22%)
Similarity:90/241 - (37%) Gaps:64/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 ETPLYQVL-----RANLITFIKTVLGMKDWPEMDILR-------IAAILDTNTFEVRQPRERRKI 245
            ||.:|:|:     ...:|..:|..:|.:.:.|..::|       |...|.|.|.| .|....|..
pombe     5 ETEIYKVVPIPNKGMGMIAKVKIPVGTRIFAETPLIRTKSDAKEIEEALSTKTKE-EQEAFHRLF 68

  Fly   246 RA-----------LYPGAAMI--------------SHDCVPNMRHRFDDDMNIVFL-AKRKIAKG 284
            .|           .|..|..|              :|||.||::|.::..::.|.: |.|.|..|
pombe    69 NAHPDTMGPFLGPFYSNALTIDETKGGMFLLGSRMNHDCSPNVKHTWNPRLDQVTVHAVRDIEAG 133

  Fly   285 EILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCLKCKAGKIISLNPLLN 349
            |.:..:|....:|..:|:..|.:...|.|.|:.|...|.             |..||..|.    
pombe   134 EEILTTYIDLHKSHTERQKILLEHFGFKCYCSVCSVEER-------------KIRKISDLR---- 181

  Fly   350 SAPWKCQLCNFKRS-AKDVVTSDAELQQELESLDKTTPVALEEFIY 394
                :.||..:.|: ||..:.:.   :..|.:|.....:|.||.::
pombe   182 ----RKQLAYYDRTMAKMCIVNP---RGALRALRHRIHIAHEELLF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 16/70 (23%)
set5NP_588413.1 SET <1..319 CDD:225491 55/241 (23%)
SET 4..147 CDD:214614 33/142 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.