DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and set-10

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_493620.2 Gene:set-10 / 185237 WormBaseID:WBGene00009370 Length:430 Species:Caenorhabditis elegans


Alignment Length:439 Identity:93/439 - (21%)
Similarity:142/439 - (32%) Gaps:162/439 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CALC--QAKASQ-----LCAACRNVVYCSREHQKEHWKKGHRSECQCFEIATNEVLGRHLRATRD 66
            ||.|  :..:||     .|..|..|.||:.:.|::.||..|:.||:                   
 Worm    23 CATCFLEIDSSQETEILTCDDCLAVSYCTLKCQRKDWKSCHQFECE------------------- 68

  Fly    67 IKIGEQILKEAPLVLGPKVASAPLCLG---CHRNLLAPGKPRGNYHKCSSCSWPLCGKECEDSVH 128
                         :|..:.:|.|:.|.   |.|.|||          ..|...|           
 Worm    69 -------------ILRCQGSSTPMTLTMKLCIRVLLA----------SRSTQTP----------- 99

  Fly   129 HKAECQLMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDPDAFLKLYNLEDHLKERLE 193
                       :|...:                                   |.:||.:.||...
 Worm   100 -----------SFNGAV-----------------------------------LEDLETNYKEFRS 118

  Fly   194 TPLYQVLRANLITFIKTVLGMKDWP-----EMDILRIAAILDTNTFEVRQPRERRKI-RALYPGA 252
            :|.:....::::|.|.: .|...:|     ...|..|.::| .|:|.:...:....| ..||.|.
 Worm   119 SPEHNQFLSDVLTIISS-SGQNIFPTSLETNKTIGIICSVL-CNSFSIINEKRVEPIGSGLYVGV 181

  Fly   253 AMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCAR 317
            |..:|.|.......|:.  |.|||...:....:.|:|||...:..|.:||..:|......|.|..
 Worm   182 AKHNHSCASTSHVVFEG--NQVFLRTNQEEYSKELTISYVSRMLPTSERRKTIRGVHFLTCQCEM 244

  Fly   318 CQDPEEL---------------GSFAGAQTCLKCKAGKIISLNPLLNSAPWKCQLCNFKRSAKDV 367
            |:: |||               |...|:..|..|:                |.....|::|    
 Worm   245 CKN-EELDLIGLSSKCRTKNCTGFVKGSGNCSVCE----------------KLAFLPFEQS---- 288

  Fly   368 VTSDAELQQELESLDKT---TPVALEEFIYRHRAD----LHETNTHILQ 409
            :.|...|...:|:|.||   |.|....::.:.|||    |.|.|..|||
 Worm   289 IHSTLNLLDIIENLHKTNQFTTVQELAYLQKLRADYQDILAECNVAILQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 14/43 (33%)
SET <246..291 CDD:214614 13/44 (30%)
set-10NP_493620.2 zf-MYND 23..67 CDD:366792 14/43 (33%)
SET 57..247 CDD:394802 55/292 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.