DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and MSS51

DIOPT Version :10

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001019764.1 Gene:MSS51 / 118490 HGNCID:21000 Length:460 Species:Homo sapiens


Alignment Length:78 Identity:27/78 - (34%)
Similarity:32/78 - (41%) Gaps:14/78 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CALCQAKASQL--------CAACRNVVYCSREHQKEHWKKGHRSECQCFEIATNEVLGRHLRATR 65
            ||.|:|..|.|        |..||||.||..|.||..| ..||..||...:...:.|...|..| 
Human   105 CAHCRALPSGLSDSKVLRHCKRCRNVYYCGPECQKSDW-PAHRRVCQELRLVAVDRLMEWLLVT- 167

  Fly    66 DIKIGEQILKEAP 78
                |:.:|...|
Human   168 ----GDFVLPSGP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:460312 19/44 (43%)
SET_SMYD <227..318 CDD:380997
MSS51NP_001019764.1 zf-MYND 105..149 CDD:460312 19/44 (43%)
MSS51_C 243..423 CDD:466330
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.