DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and SMYD5

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_006053.2 Gene:SMYD5 / 10322 HGNCID:16258 Length:418 Species:Homo sapiens


Alignment Length:362 Identity:88/362 - (24%)
Similarity:130/362 - (35%) Gaps:114/362 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GRHLRATRDIKIGEQILKEAPLVLGPKVASA----PLCLGCHRNL--------LAPGKP------ 104
            |:.|.||:.|:.||.|..|.|||....:.:|    ..|..|.|.|        ...|||      
Human    33 GKGLFATQLIRKGETIFVERPLVAAQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPH 97

  Fly   105 ------RGNYHK-CSSCSWPLCGKECE---DSVHHKAEC-------QLMSGSNFQS---KINYVP 149
                  |.:.|: |..|....|..||.   ...:|:..|       .|...:..|.   .|:|.|
Human    98 PELCTVRKDLHQNCPHCQVMYCSAECRLAATEQYHQVLCPGPSQDDPLHPLNKLQEAWRSIHYPP 162

  Fly   150 GEEERKESAYCVIMLLRCMHLKD-KDPDAFLKLYN-----------------LEDHLKERLETPL 196
                  |:|..::|......:|. ||.|.:::|::                 |.|..|.:||   
Human   163 ------ETASIMLMARMVATVKQAKDKDRWIRLFSQFCNKTANEEEEIVHKLLGDKFKGQLE--- 218

  Fly   197 YQVLRANLITFIKTVLGMKDWPEMDILR-IAAILDTN-----------------TFEVRQPRERR 243
               |...|.|.......:..|...|..| :.|::.||                 |.|:: |::|.
Human   219 ---LLRRLFTEALYEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDTLELK-PQDRE 279

  Fly   244 KIRA----LY-------------PGAAMI------SHDCVPNMRHRFDDDMNIVFL-AKRKIAKG 284
            ::.|    ||             .|:.:.      :|.||||....|.::..::.: |...|..|
Human   280 QLDAFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPG 344

  Fly   285 EILSISY---TQPLRSTIQRRVHLRQAKCFDCSCARC 318
            |.:.|||   .|..||...|...||:...|.|||.:|
Human   345 EEICISYLDCCQRERSRHSRHKILRENYLFVCSCPKC 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 15/68 (22%)
SMYD5NP_006053.2 SET <298..351 CDD:214614 12/52 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.