DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and smyd1

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_012811600.1 Gene:smyd1 / 100145429 XenbaseID:XB-GENE-978314 Length:491 Species:Xenopus tropicalis


Alignment Length:566 Identity:111/566 - (19%)
Similarity:193/566 - (34%) Gaps:175/566 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EIATNEVLGRHLRATRDIKIGEQILKEAPLVLGPKVA-------SAPLCLGCHRNLLAPGKPRGN 107
            ||..:|..||.|||.|:...|:.|..|      |..:       |..:|..|.       |.:..
 Frog     5 EIFESEGKGRGLRAIRESWAGDIIFAE------PAYSAVVFDNLSHSVCHSCF-------KRQEK 56

  Fly   108 YHKCSSCSWP-LCGKEC--EDSVHHKAECQLMSGSNFQSKINYVPGEE-----------ERKESA 158
            ..:|..|.:. .|.:.|  |...:||.||..:      .|....|.|.           ||:.|.
 Frog    57 LLRCGQCKFAHYCDRTCQKESWANHKNECVAI------KKAGKAPNENIRLAARILWRIEREGSG 115

  Fly   159 Y---CVIMLLRCMHLKDKDPDAFLKLYNLEDHLKERLETPLYQVLRANLITFIKTVLGMKDWPEM 220
            .   |::                 .:.:|::|: ::.:.....:|..::..|::.      ||..
 Frog   116 LTEGCLV-----------------SIDDLQNHI-DKFDEAEKGLLMEDVQKFLEY------WPSQ 156

  Fly   221 D-------ILRIAAILDTNTFEVRQPRERRKIR-ALYPGAAMISHDCVPN------------MRH 265
            .       |..|.:::..|.|.:...|..:.:. .::|...:.:|||.||            :|.
 Frog   157 SQQFGMQYISHIFSVISCNGFTLSDQRGLQAVGVGIFPNLCLANHDCWPNCTVIFNNGNHEAVRS 221

  Fly   266 RFDDDMNIVFLAKRKIAKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGA 330
            .|...|.|...|..||.|||.|::||...|..|..|:..|::...|||:|..|..          
 Frog   222 MFHTQMRIELRALGKINKGEELTVSYVDFLNLTEDRKAQLKKQYYFDCTCEHCTK---------- 276

  Fly   331 QTCLKCKAGKIISLNPLLNSAPWKCQLCNFKRSAKDVVTSDAELQQELESLDKTTPVALEEFIYR 395
                |.|...::::....:...        :|..|:|:....:..:::|.       |..|.:|.
 Frog   277 ----KTKDALLLAVKDGEDKPE--------ERVVKEVIQYSKDTMEKIEK-------ARSEGLYN 322

  Fly   396 HRADLHETNTHILQAKYALTQLYGSAPGFAMEELSGESLNRKLQLCEELLKLADIFDG------- 453
            ....|........:..:|.|.:|               :.|.|.:..|:|....:||.       
 Frog   323 DVVKLCRDCLKRQEPIFADTNIY---------------MLRILSIYSEVLSYLQMFDDAAENAKK 372

  Fly   454 ----------------GWSIFRGNL------LIDMEEALVTQA----LRSKDPL-----DCEEKL 487
                            |.::.|..:      :|::...::.:|    |.:..||     |. |.:
 Frog   373 MVDGYLKIYHQNNAQLGMAVMRAGVTHWHAGMIEVGHGMICKAFAILLITHGPLHPITKDL-EVM 436

  Fly   488 RNAAEMLREIRNIMKHE---PEMQQLLLERQVILSSALERFEPVEN 530
            |...||  |:|...::|   .:|::..|..:..........||..|
 Frog   437 RAQTEM--ELRMFKENEFVYYKMREAALSNKPFQVMKEPNSEPATN 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 17/57 (30%)
smyd1XP_012811600.1 zf-MYND 47..85 CDD:280009 10/44 (23%)
SET <189..252 CDD:214614 19/62 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.