DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3808 and TRMT2B

DIOPT Version :9

Sequence 1:NP_649083.2 Gene:CG3808 / 40074 FlyBaseID:FBgn0036838 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001161442.1 Gene:TRMT2B / 79979 HGNCID:25748 Length:504 Species:Homo sapiens


Alignment Length:478 Identity:171/478 - (35%)
Similarity:262/478 - (54%) Gaps:41/478 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 GKVLKAHVAKASADPLQKKRAAEEQESERKPKK--------QRTAVEATCPLSHIAYDQQIKQKS 180
            |.|.|....:..|...||     .|:|::||..        |....:...||..::|::|:|.|.
Human    45 GTVCKGDFTRVIATKCQK-----GQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQLKVKF 104

  Fly   181 EEMSALLAK---YTQELRKVN-PRAKPHLDKFQ--FHEVLPSPTVNGYRNKNEFTVGKNSVGE-V 238
            .....:|.:   |.|.|..|: ..|.|..::..  .|.::|||.:||||||:.|:|.:...|. .
Human   105 AAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPK 169

  Fly   239 VVGFRLGCYSDGSVEVAEVADLPHLPEQAKWAARSFQDLVRKSKFLPFNP-----DGNIGHFRQL 298
            .|||.||.:.||:|...:...|.::||:....|:.::..:|:|   |..|     :|  |::|:|
Human   170 TVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQS---PLEPCLVFHEG--GYWREL 229

  Fly   299 MVRCSSATGELMLVAGIYSSNLSEDEQVELKQELKSFYEDLANDAPYKCSSLYYQDVKHREAGQT 363
            .||.:| .|..|.:...:...||::|....|:.:|.|: .....|....:|||:|:.........
Human   230 TVRTNS-QGHTMAIITFHPQKLSQEELHVQKEIVKEFF-IRGPGAACGLTSLYFQESTMTRCSHQ 292

  Fly   364 INPVEHISGSTHITDTIQGLQFRISPLAFFQINTEGANVLYQKAIDLVAPTKDTTMLDICCGTGT 428
            .:|.:.:.|..:|.:.:..|:.||||.|||||||.||.:||:...:|.....||.:||||||||.
Human   293 QSPYQLLFGEPYIFEELLSLKIRISPDAFFQINTAGAEMLYRTVGELTGVNSDTILLDICCGTGV 357

  Fly   429 ITLAFAKHCKKVMGVEIVPDAIKDAEFNAEANGIKNAKFFTGNADDFIKSMVREALYDQEPGKPL 493
            |.|:.|:|..:|:|:|::..|::||.:.|..|||.|::|.||.|:..:..:::    .:|.|:  
Human   358 IGLSLAQHTSRVLGIELLEQAVEDARWTAAFNGITNSEFHTGQAEKILPGLLK----SKEDGQ-- 416

  Fly   494 DLIAVVDPPRAGLHHRSIAAIRSADAINRLVYVSCNPH-SAKRNFIELARP--ESKQYKGEPFYP 555
            .::|||:|.|||||::.|.|||:..||:.||:|||..| .:.||.|||..|  .:|:..||||..
Human   417 SIVAVVNPARAGLHYKVIQAIRNFRAIHTLVFVSCKLHGESTRNVIELCCPPDPAKKLLGEPFVL 481

  Fly   556 KSAVAVDMFPHTMHTELVILFER 578
            :.||.||:||||.|.|||:||.|
Human   482 QQAVPVDLFPHTPHCELVLLFTR 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3808NP_649083.2 RRM_TRMT2A 56..134 CDD:240885 3/9 (33%)
TrmA 57..571 CDD:225174 165/469 (35%)
AdoMet_MTases 276..579 CDD:302624 122/311 (39%)
TRMT2BNP_001161442.1 TrmA 94..497 CDD:225174 152/415 (37%)
AdoMet_MTases <298..501 CDD:302624 94/208 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54357
OrthoDB 1 1.010 - - D248059at2759
OrthoFinder 1 1.000 - - FOG0001356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1692
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.