DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and PGC1

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_015118.1 Gene:PGC1 / 855895 SGDID:S000006127 Length:321 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:48/207 - (23%)
Similarity:78/207 - (37%) Gaps:78/207 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 VGHRGNGKSYIADAPAERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGLRTAPPGKQI 520
            ||||    ::.|..|   |||:.:|..|:...||:||.|:.:|:||:.|:.||     :..|:..
Yeast     5 VGHR----AFKARYP---ENTLLAFEKAYAAGADVIETDLQMTSDGMVVVNHD-----SDTGRMW 57

  Fly   521 SRPDQLEYVLIKDINYELLKRLRIFSVIAGQVREYPSHNAEPRMEHRIFPTLVEVLEKLPKSLGI 585
            .:     .::|.:..:|.:||||        .:|..|         ....||.|:|         
Yeast    58 DK-----NLVIGESTWEEVKRLR--------CKEDGS---------LAMMTLKEIL--------- 91

  Fly   586 DVEIKWPQRRQGGGSEAEQTIDKNFFADKVIHQVIQKGCGRPIIFSSFDADMCTMLRFKQNVFPV 650
                .|.....|    |:..:|..|..:|:|                       |::    .|.:
Yeast    92 ----TWAVCHPG----AKLMLDIKFTNEKII-----------------------MIK----TFVI 121

  Fly   651 MFLTQGETKKWQ 662
            |...:.:.|.||
Yeast   122 MLEVKNDLKFWQ 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 48/207 (23%)
GDPD 458..744 CDD:281062 46/205 (22%)
PGC1NP_015118.1 GDPD_YPL206cp_fungi 4..244 CDD:176512 48/207 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.