Sequence 1: | NP_788526.1 | Gene: | CG18135 / 40073 | FlyBaseID: | FBgn0036837 | Length: | 770 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015118.1 | Gene: | PGC1 / 855895 | SGDID: | S000006127 | Length: | 321 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 78/207 - (37%) | Gaps: | 78/207 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 456 VGHRGNGKSYIADAPAERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGLRTAPPGKQI 520
Fly 521 SRPDQLEYVLIKDINYELLKRLRIFSVIAGQVREYPSHNAEPRMEHRIFPTLVEVLEKLPKSLGI 585
Fly 586 DVEIKWPQRRQGGGSEAEQTIDKNFFADKVIHQVIQKGCGRPIIFSSFDADMCTMLRFKQNVFPV 650
Fly 651 MFLTQGETKKWQ 662 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18135 | NP_788526.1 | CBM20_Prei4 | 166..288 | CDD:99888 | |
GDPD_GDE5 | 454..741 | CDD:176549 | 48/207 (23%) | ||
GDPD | 458..744 | CDD:281062 | 46/205 (22%) | ||
PGC1 | NP_015118.1 | GDPD_YPL206cp_fungi | 4..244 | CDD:176512 | 48/207 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0584 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |