DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and GDPD2

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_198924.1 Gene:GDPD2 / 834110 AraportID:AT5G41080 Length:374 Species:Arabidopsis thaliana


Alignment Length:217 Identity:61/217 - (28%)
Similarity:102/217 - (47%) Gaps:39/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 VGHRGNGKSYIAD----APAERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGLRTAPP 516
            :||||.|.:.:..    |...:||:|.||.||.::..|.||.||.:|.|..|||:||..:.:...
plant    41 IGHRGIGMNVLQSSDRRARGVKENSILSFNSAAKYPIDFIEFDVQVTKDDCPVIFHDDFIYSEEN 105

  Fly   517 G----KQISRPDQLEYVL------IKDINYELLKRLRIFSVIAGQVREYPSHNAEPRMEHRIFPT 571
            |    .:::.....|::|      .:.|...|:::.:...|:...|....|           ..|
plant   106 GIVNESRVTDLSLSEFLLYGPQKETEKIGKTLMRKSKEGKVLKWDVDLDDS-----------LCT 159

  Fly   572 LVEVLEKLPKSLGIDVEIKWPQRRQGGGSEAEQTIDKNFFADKVIHQVIQ----KGCGRPIIFSS 632
            |.|..|::.::||.::|:|:.          :||:.:..|...::..|:|    ....||:||||
plant   160 LQEAFEQVEQTLGFNIELKFD----------DQTVYEREFLVHILRSVLQVVSNYAKDRPVIFSS 214

  Fly   633 FDADMCTMLRFKQNVFPVMFLT 654
            |..|...::|..|:.:||.|||
plant   215 FQPDAAKLVRELQSTYPVFFLT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 61/217 (28%)
GDPD 458..744 CDD:281062 60/215 (28%)
GDPD2NP_198924.1 GDPD_GDE5_like_1_plant 39..319 CDD:176547 61/217 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2222
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D687958at2759
OrthoFinder 1 1.000 - - FOG0001717
OrthoInspector 1 1.000 - - mtm976
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22958
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.