DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and GDPD5

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_011543578.1 Gene:GDPD5 / 81544 HGNCID:28804 Length:606 Species:Homo sapiens


Alignment Length:162 Identity:42/162 - (25%)
Similarity:70/162 - (43%) Gaps:38/162 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 PKSWPNLDVGHRGNGKSYIADAP-AERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGL 511
            ||  |.| :||||        || ...|:|:.||..|.|.....::.|:.::.||||.:.||..|
Human   226 PK--PAL-IGHRG--------APMLAPEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTL 279

  Fly   512 RTAPPGKQ-----ISRPDQLEYVLIKDINYELLKRLRIFSVIAGQ--VREYP-------SHNAEP 562
            |.....::     ..||..:       :|:..|:||.     |||  ::..|       |.:...
Human   280 RRTTNVEEEFPELARRPASM-------LNWTTLQRLN-----AGQWFLKTDPFWTASSLSPSDHR 332

  Fly   563 RMEHRIFPTLVEVLEKLPKSLGIDVEIKWPQR 594
            ..:::...:|.|:||....:..:.:.::.|.|
Human   333 EAQNQSICSLAELLELAKGNATLLLNLRDPPR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 39/156 (25%)
GDPD 458..744 CDD:281062 37/152 (24%)
GDPD5XP_011543578.1 GDPD_GDE2 227..577 CDD:176550 41/161 (25%)
UgpQ 227..468 CDD:223657 41/161 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.