DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and Gde1

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_062526.1 Gene:Gde1 / 56209 MGIID:1891827 Length:331 Species:Mus musculus


Alignment Length:345 Identity:77/345 - (22%)
Similarity:134/345 - (38%) Gaps:101/345 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 YVAVQPYRYSPLDFKNTYAHYWPKSWPNLDVGHRGNGKSYIADAPAERENTIASFLSAHEHHADM 490
            |:.::.:.:.|:..:.......|:...:. :.|||...    |||   |||:|:...|.::.|..
Mouse    39 YILLRFFSFEPVPSRRALQVLKPRDRVSA-IAHRGGSH----DAP---ENTLAAIRQAAKNGATG 95

  Fly   491 IELDVHLTADGVPVIYHDFGLRTAPPGKQISRPDQLEYVLIKDINYELLKRLRIFSVIAGQVREY 555
            :|||:..|:|||||:.||..:.....|.  .|...|.:..::.:|.....|||         .|:
Mouse    96 VELDIEFTSDGVPVLMHDNTVDRTTDGS--GRLCDLTFEQVRKLNPAANHRLR---------NEF 149

  Fly   556 PSHNAEPRMEHRIFPTLVE-VLEKLPKSLGIDVEIKWPQRRQGGGSEAEQTIDKNFFAD------ 613
            |        :.|| |||.| |.|.|..:|.|..::|       |.::......||.:.:      
Mouse   150 P--------DERI-PTLKEAVTECLRHNLTIFFDVK-------GHADMASAALKNIYTEFPQLYN 198

  Fly   614 ---------KVIHQVIQ------------------KGCGRPIIFSSFDADMCTMLRFKQNVFPVM 651
                     :||:::.|                  .|.|:| .:|.|         :||:||.|:
Mouse   199 NSMVCSFLPEVIYKMRQTDQKVITALTHRPWSLSHTGDGKP-RYSVF---------WKQSVFVVL 253

  Fly   652 FLTQGETKKWQPFLDLRTRTFIAAVNNAQAFELAGTAPHAEDFLGENASEMLRKAKDLGQIAVIW 716
            .:          .||......:..:....||.:      .:||:   :.:.|:|....|...|.|
Mouse   254 DI----------LLDWSMHNVLWYLCGISAFLM------QKDFV---SPDYLKKWSAKGIQVVSW 299

  Fly   717 GDDCNSKERVQYF-TRIGAT 735
              ..|:.:...|: :.:|::
Mouse   300 --TVNTFDEKNYYESHLGSS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 74/317 (23%)
GDPD 458..744 CDD:281062 74/313 (24%)
Gde1NP_062526.1 GDPD_GDE1 68..323 CDD:176515 74/315 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.