powered by:
Protein Alignment CG18135 and gdpd5b
DIOPT Version :9
Sequence 1: | NP_788526.1 |
Gene: | CG18135 / 40073 |
FlyBaseID: | FBgn0036837 |
Length: | 770 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005157799.1 |
Gene: | gdpd5b / 560645 |
ZFINID: | ZDB-GENE-030131-6028 |
Length: | 584 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 23/73 - (31%) |
Similarity: | 35/73 - (47%) |
Gaps: | 9/73 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 456 VGHRGNGKSYIADAP-AERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGLRTAPPGKQ 519
:||:| || ...|||:.||..|.:.:...:|.||.::.||||.:..|..||.....::
Zfish 231 IGHQG--------APMLAPENTLLSFNRALQRNVSGLETDVTISLDGVPFLMRDRTLRRTTNVRR 287
Fly 520 ISRPDQLE 527
:....|.|
Zfish 288 VFPERQYE 295
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0584 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.