DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and gdpd5a

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_009303864.1 Gene:gdpd5a / 555247 ZFINID:ZDB-GENE-091204-253 Length:600 Species:Danio rerio


Alignment Length:283 Identity:60/283 - (21%)
Similarity:110/283 - (38%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 VGHRGNGKSYIADAP-AERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGLRTAP---- 515
            :|.||        || ...|:|:.||..|.:.....:|.||.::.||||.:..|..||...    
Zfish   231 IGRRG--------APMLAPEHTLMSFSKALQQKVTALEADVAISLDGVPFLMRDRTLRRTTDVDR 287

  Fly   516 --PGKQISRPDQLEYVLIKDINYEL--LKRLRIFSVIAGQVREYPSHNAEPRMEHRIFPTLVEVL 576
              |.:|.:......:..|:.:|..|  |:....::|      :|.|.....|..::...:|.|:|
Zfish   288 LFPARQDTDASFFNWTEIRSLNAGLWFLRDDPYWTV------QYMSEKDRKRAGNQTVCSLAELL 346

  Fly   577 EKLPKSLGIDVEIKWPQRRQGGGSEAEQTIDKNFFADKVIHQVIQKGCGRPIIFSSFDADMCTML 641
            ....::   :..:.:..||........|.    :.:|.:  :|||:...:|      :..|.|..
Zfish   347 RVAARA---NRSVIFSLRRPPPNHPRHQL----WVSDAL--KVIQRSSIQP------EQVMWTPD 396

  Fly   642 RFKQNVFPVMFLTQGETKKWQPFLDLRTR---TFIAAVNNAQAFELAGTAPHAEDFLGENASEML 703
            .:::.|...:.|.|..|.:..|..:|:.|   |.....:.|:|.|:       ..|...|.|..:
Zfish   397 WYRKKVRAAVPLLQQTTDEKLPVAELKERGITTLTLHYSQARAQEI-------RQFSVSNVSVNV 454

  Fly   704 RKAKDLGQIAVIWGDDCNSKERV 726
            ....:....:::|   |:..:.|
Zfish   455 YPVNEPWLYSLMW---CSGVQSV 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 60/283 (21%)
GDPD 458..744 CDD:281062 59/281 (21%)
gdpd5aXP_009303864.1 PI-PLCc_GDPD_SF 227..582 CDD:301322 60/283 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.