DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and GDPD2

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001164663.1 Gene:GDPD2 / 54857 HGNCID:25974 Length:590 Species:Homo sapiens


Alignment Length:256 Identity:64/256 - (25%)
Similarity:100/256 - (39%) Gaps:62/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 PKSWPNLDVGHRGNGKSYIADAP-AERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGL 511
            ||  |.| |||||        || ...|||:.|.....|..|.:.|.||.:::||||.:.||   
Human   222 PK--PGL-VGHRG--------APMLAPENTLMSLRKTAECGATVFETDVMVSSDGVPFLMHD--- 272

  Fly   512 RTAPPGKQISRPDQLEYVL-------IKDINYELLKRLRIFSVIAGQ--VREYPSHNAEP----- 562
                  :.:||...:..|.       ..|.::..||||.     ||.  :...|...|:|     
Human   273 ------EHLSRTTNVASVFPTRITAHSSDFSWTELKRLN-----AGSWFLERRPFWGAKPLAGPD 326

  Fly   563 --RMEHRIFPTLVEVLEKLPKSLGIDVEIKWPQRRQGGGSEAEQTIDKNFFADKVIHQVIQKGCG 625
              ..|.:..|.|.|:||   ::..:::.|.:..||.........|     |..:.:..|:.....
Human   327 QKEAESQTVPALEELLE---EAAALNLSIMFDLRRPPQNHTYYDT-----FVIQTLETVLNARVP 383

  Fly   626 RPIIFSSFDADMCTMLRFKQNVFPVMFLTQG--ETKKWQ---------PFLDLRTRTFIAA 675
            :.::|...|.|...:.|....:..: :..||  .|::.|         |.||::.|..:.|
Human   384 QAMVFWLPDEDRANVQRRAPGMRQI-YGRQGGNRTERPQFLNLPYQDLPLLDIKDRFLLPA 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 61/250 (24%)
GDPD 458..744 CDD:281062 58/246 (24%)
GDPD2NP_001164663.1 PI-PLCc_GDPD_SF 202..563 CDD:326331 64/256 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.