DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and CG14883

DIOPT Version :10

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster


Alignment Length:70 Identity:20/70 - (28%)
Similarity:29/70 - (41%) Gaps:10/70 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 WPKSWPNLDVGHRGNGKSYIADAPAERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGL 511
            ||..||   :.:|..|    .|||   ||:.|:...........:.||..||:.|..|:.:...:
  Fly    78 WPSYWP---IANRAAG----FDAP---ENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI 132

  Fly   512 RTAPP 516
            ..|.|
  Fly   133 NVAQP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 16/63 (25%)
CG14883NP_650547.1 PI-PLCc_GDPD_SF 84..320 CDD:472694 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.