DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and Gdpd3

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001292116.1 Gene:Gdpd3 / 293490 RGDID:1308386 Length:320 Species:Rattus norvegicus


Alignment Length:201 Identity:52/201 - (25%)
Similarity:80/201 - (39%) Gaps:64/201 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 LRLPYVAVQPYRYSPLDFKNTYAHYWPKSWPNLDVGHRGNGKSYIADAPAER-ENTIASFLSAHE 485
            ||.|::...|               |...:......|||..        .|| |||:.:..::..
  Rat    23 LRRPHLLHTP---------------WAPGFSIRLAAHRGGS--------GERLENTMEAIENSMA 64

  Fly   486 HHADMIELDVHLTADGVPVIYHDFGLRTAPPGKQISRPDQLEYVLIKDINYELLKRLRIFSVIAG 550
            ..||::|.|..||.|||.|:.||         |.:||...|.    ||||.....:|.::.   .
  Rat    65 QRADLLEFDCQLTRDGVVVVSHD---------KNLSRQSGLN----KDINTLDFAQLPLYK---E 113

  Fly   551 QVREY--PSHNAEPRMEHRIFPTLVEVLEKLPKSLGIDVEIKWPQRRQGGGSEAEQTIDKNFFAD 613
            ::..|  |.|.|.....|.|  :|.:|.:|.|:: .:.:|||                :||   :
  Rat   114 ELEIYFSPGHFAHGSDRHMI--SLEDVFQKFPRT-PMCLEIK----------------EKN---E 156

  Fly   614 KVIHQV 619
            ::||:|
  Rat   157 ELIHKV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 47/169 (28%)
GDPD 458..744 CDD:281062 47/165 (28%)
Gdpd3NP_001292116.1 GDPD_GDE4 13..310 CDD:176553 52/201 (26%)
UgpQ 39..311 CDD:223657 47/170 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.