DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and GDPD1

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_872375.2 Gene:GDPD1 / 284161 HGNCID:20883 Length:314 Species:Homo sapiens


Alignment Length:311 Identity:72/311 - (23%)
Similarity:114/311 - (36%) Gaps:115/311 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 VGHRGNGKSYIADAPAERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGLRTAPPGKQI 520
            :.|||.       |....|||:|:|..|.:...||:|||.|:|.|...|:.||..|:.| .|..:
Human    43 ISHRGG-------AGENLENTMAAFQHAVKIGTDMLELDCHITKDEQVVVSHDENLKRA-TGVNV 99

  Fly   521 SRPDQLEYVLIKDINY-EL---LKRLRIFSVIAGQVREYPSHNAEPRMEHRIFPTLVEVLEKLPK 581
            :         |.|:.| ||   |.:|.:....|.|..         ..::|| |.|.||.|..|.
Human   100 N---------ISDLKYCELPPYLGKLDVSFQRACQCE---------GKDNRI-PLLKEVFEAFPN 145

  Fly   582 SLGIDVEIKWPQRRQGGGSEAEQTIDKNFFADKVI------------------HQVIQKGCGR-- 626
            : .|:::||               ::.|....||.                  :::::| |.:  
Human   146 T-PINIDIK---------------VNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEK-CYKEN 193

  Fly   627 ---PIIFS---------SFDADMCTMLRFKQNVF----PVMFL------TQGETKKWQPFL-DL- 667
               ||:||         .|...:...:..::..|    |.:.|      |...::|:..:| || 
Human   194 SDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLL 258

  Fly   668 -------------RTRTFIAAVNNAQ----AFELAGTAPHAE------DFL 695
                         ..:.:|..:|..|    ||:|..|....:      |||
Human   259 LMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLRDFL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 72/311 (23%)
GDPD 458..744 CDD:281062 72/309 (23%)
GDPD1NP_872375.2 GDPD_GDE4 14..311 CDD:176553 72/311 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.