DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and Gdpd4

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_006507674.1 Gene:Gdpd4 / 233537 MGIID:3606573 Length:730 Species:Mus musculus


Alignment Length:223 Identity:57/223 - (25%)
Similarity:88/223 - (39%) Gaps:56/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 YSPLDFKNTYAHYWPKSWPNLDVGHRGNGKSYIADAP-AERENTIASFLSAHEHHADMIELDVHL 497
            |||...|.  .:..||  |.| .||||        || ...|||:.||..|.|.....:|.|::|
Mouse   262 YSPCILKK--ENLGPK--PTL-FGHRG--------APMLAPENTMMSFEKAVELDVSGLETDIYL 313

  Fly   498 TADGVPVIYHDFGLRTAPPGKQISRPDQLEYVL-------IKDINYELLKRLRIFSVIAGQ--VR 553
            :.|.||.:.||:.|         :|...::.||       ..:.|:..|..|.     ||:  ::
Mouse   314 SFDSVPFLMHDYDL---------TRTTNIKEVLPSAAGNHTSNFNWTFLSTLN-----AGKWFLK 364

  Fly   554 EYPSHNAEP-------RMEHRIFPTLVEVLEKLPKSLGIDV-EIKWPQRRQGGGSEAEQTIDKNF 610
            ..|....:|       |..::..|.|.|:|....:...|.: ::..|  |.|...       :|.
Mouse   365 HKPFFGMKPLSEADKRRAGNQSIPQLSELLALAKREQKIVIFDLFGP--RPGHPL-------RNT 420

  Fly   611 FADKVIHQVIQKGCGRPIIF--SSFDAD 636
            |..:|:..::.....:.:||  ..||.|
Mouse   421 FVRRVVKVILDSKIEQRLIFWLPGFDRD 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888
GDPD_GDE5 454..741 CDD:176549 50/203 (25%)
GDPD 458..744 CDD:281062 48/199 (24%)
Gdpd4XP_006507674.1 PI-PLCc_GDPD_SF 254..567 CDD:387364 57/223 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.